Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D1 Olfactory Receptor

Gene Symbol OR4D11 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR17-23, AC005962-A, HSTPCR16, HsOR17.2.1, ORL207
External Ids HGNC: 8293   GeneBank: AB065913, AF399567, BK004544, HSTPCR16P, NM_012374   ORDB: ORL207   
Build #39 labels OR4D1
Chromosomal location 17:58,155,154-58,156,083 (+)
Cluster 17@56
Synteny CLIC#40
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D2 79.87% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D1 88% 310
Chimp CONTIG237.208-20896 80% 303
Chimp CONTIG237.210-275 98% 246
Mouse Or4d1 86% 310
Rat Or4d2 81% 311
Cow OR4D1 85% 311
Cow OR4D1B 84% 311
Cow OR4D2D 83% 310
Cow OR4D2E 83% 310

Expression evidences

Source Accession
mRNA X89670
GNF Atlas2 gnf1h05923_at

Sequence information

Nucleotide sequence ATGGAACCACAGAACACCACACAGGTATCAATGTTTGTCCTCTTAGGGTTTTCACAGACC
CAAGAGCTCCAGAAATTCCTGTTCCTTCTGTTCCTGTTAGTCTATGTTACCACCATTGTG
GGAAACCTCCTTATCATGGTCACAGTGACTTTTGACTGCCGGCTCCACACACCCATGTAT
TTTCTGCTCCGAAATCTAGCTCTCATAGACCTCTGCTATTCCACAGTCACCTCTCCAAAG
ATGCTGGTGGACTTCCTCCATGAGACCAAGACGATCTCCTACCAGGGCTGCATGGCCCAG
ATCTTCTTCTTCCACCTTTTGGGAGGTGGGACTGTCTTTTTTCTCTCAGTCATGGCCTAT
GACCGCTACATAGCCATCTCCCAGCCCCTCCGGTATGTCACCATCATGAACACTCAATTG
TGTGTGGGCCTGGTAGTAGCCGCCTGGGTGGGGGGCTTTGTCCACTCCATTGTCCAACTG
GCTCTGATACTTCCACTGCCCTTCTGTGGCCCCAATATCCTAGATAACTTCTACTGTGAT
GTTCCCCAAGTACTGAGACTTGCCTGCACTGATACCTCCCTCCTGGAGTTCCTCATGATC
TCCAACAGTGGGCTGCTAGTTATCATCTGGTTCCTCCTCCTTCTGATCTCTTATACTGTC
ATCCTGGTGATGCTGAGGTCCCACTCGGGAAAGGCAAGGAGGAAGGCAGCTTCCACCTGC
ACCACCCACATCATCGTGGTGTCCATGATCTTCATTCCCTGTATCTATATCTATACCTGG
CCCTTCACCCCATTCCTCATGGACAAGGCTGTGTCCATCAGCTACACAGTCATGACCCCC
ATGCTCAACCCCATGATCTACACCCTGAGAAACCAGGACATGAAAGCAGCCATGAGGAGA
TTAGGCAAGTGCCTAGTAATTTGCAGGGAG
Conceptual translation MEPQNTTQVSMFVLLGFSQTQELQKFLFLLFLLVYVTTIVGNLLIMVTVTFDCRLHTPMY
FLLRNLALIDLCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAY
DRYIAISQPLRYVTIMNTQLCVGLVVAAWVGGFVHSIVQLALILPLPFCGPNILDNFYCD
VPQVLRLACTDTSLLEFLMISNSGLLVIIWFLLLLISYTVILVMLRSHSGKARRKAASTC
TTHIIVVSMIFIPCIYIYTWPFTPFLMDKAVSISYTVMTPMLNPMIYTLRNQDMKAAMRR
LGKCLVICRE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 56,233,168 56,233,168 nonsense SNP A/T */Y rs71372828 (DbSNP)
17 56,233,034 56,233,034 NS A/C I/L rs7218964 (DbSNP)
17 56,232,675 56,232,675 NS A/G Q/R rs12602205 (DbSNP)
17 56,233,164 56,233,164 NS C/T S/F rs28602491 (DbSNP)
17 56,232,977 56,232,977 NS C/T H/Y rs62636636 (DbSNP)
17 56,233,132 56,233,132 SYN A/G L/L rs17822299 (DbSNP)
17 56,232,787 56,232,787 SYN C/G T/T rs17222013 (DbSNP)
17 56,233,234 56,233,234 SYN C/T C/C rs62636635 (DbSNP)
17 58,155,873 58,155,873 SYN C/T C/C 1000GP (CEU)
17 58,155,673 58,155,673 NS C/A L/I 1000GP (CEU, CHBJPT)
17 58,155,892 58,155,892 NS G/A V/M 1000GP (CEU)
17 58,155,314 58,155,314 NS G/A R/Q 1000GP (CEU)
17 58,155,258 58,155,258 SYN T/C Y/Y 1000GP (CEU)
17 100 -100 NS G/A R/Q 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 241 (Hasin)
17 56,232,346 56,232,526 Del(-15) #25(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I69V Y120C P129T H155Y L174I S217F % Freq CORP
1 I Y P H L S 74.73 0.075
2 I Y P H I S 23.20 0.075
3 I Y P H L F 0.69 0.194
4 I Y P Y L S 0.69 0.075
5 I C P H L S 0.46 0.075
6 V Y P H L S 0.08 0.075
7 V Y P H I S 0.08 0.075
8 I Y T H L S 0.08 0.147

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4D1.aApr07-unspliced main_exon CDS chr17 58,155,154 58,156,083 +
3UTR chr17 58,156,083 58,156,086 +