Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D10 Olfactory Receptor

Gene Symbol OR4D101 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.52 (pseudogene)
Aliases OR11-251, HsOR11.13.8
External Ids HGNC: 15173   GeneBank: AB065808, AF399442, AF546476-AF546489, BK004311, NM_001004705   
Build #39 labels OR4D10P
Chromosomal location 11:59,477,430-59,478,362 (+)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D8P 91.72% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D9C 89% 311
Chimp CONTIG466.3-7038 98% 308
Mouse Or4d10c 86% 309
Mouse Or4d10 88% 306
Mouse Or4d10b 86% 304
Rat Or4d11 80% 310
Rat Or4d10c 86% 309
Rat Or4d10 86% 308
Cow OR4D9D 78% 311
Cow OR4D11B 83% 311
Cow OR4D31 83% 309
Cow OR4D32 82% 304

Expression evidences

Source Accession
mRNA BC136894
GNF Atlas2 gnf1h02109_s_at

Sequence information

Nucleotide sequence ATGGAGATGGAAAACTGCACCAGGGTAAAAGAATTTATTTTCCTTGGCCTGACCCAGAAT
CGGGAAGTGAGCTTAGTCTTATTTCTTTTCCTACTCTTGGTGTATGTGACAACTTTGCTG
GGAAACCTCCTCATCATGGTCACTGTTACCTGTGAATCTCGCCTTCACACGCCCATGTAT
TTTTTGCTCCATAATTTATCTATTGCCGATATCTGCTTCTCTTCCATCACAGTGCCCAAG
GTTCTGGTGGACCTTCTGTCTGAAAGAAAGACCATCTCCTTCAATCATTGCTTCACTCAG
ATGTTTCTATTCCACCTTATTGGAGGGGTGGATGTATTTTCTCTTTCGGTGATGGCATTG
GATCGATATGTGGCCATCTCCAAGCCCCTGCACTATGCGACTATCATGAGTAGAGACCAT
TGCATTGGGCTCACAGTGGCTGCCTGGTTGGGGGGCTTTGTCCACTCCATCGTGCAGATT
TCCCTGTTGCTCCCACTCCCTTTCTGCGGACCCAATGTTCTTGACACTTTCTACTGTGAT
GTCCACCGGGTCCTCAAACTGGCCCATACAGACATTTTCATACTTGAACTACTAATGATT
TCCAACAATGGACTGCTCACCACACTGTGGTTTTTCCTGCTCCTGGTGTCCTACATAGTC
ATATTATCATTACCCAAGTCTCAGGCAGGAGAGGGCAGGAGGAAAGCCATCTCCACCTGC
ACCTCCCACATCACTGTGGTGACCCTGCATTTCGTGCCCTGCATCTATGTCTATGCCCGG
CCCTTCACTGCCCTCCCCATGGATAAGGCCATCTCTGTCACCTTCACTGTCATCTCCCCT
CTGCTCAACCCCTTGATCTACACTCTGAGGAACCATGAGATGAAGTCAGCCATGAGGAGA
CTGAAGAGAAGACTTGTGCCTTCTGATAGAAAA
Conceptual translation MEMENCTRVKEFIFLGLTQNREVSLVLFLFLLLVYVTTLLGNLLIMVTVTCESRLHTPMY
FLLHNLSIADICFSSITVPKVLVDLLSERKTISFNHCFTQMFLFHLIGGVDVFSLSVMAL
DRYVAISKPLHYATIMSRDHCIGLTVAAWLGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VHRVLKLAHTDIFILELLMISNNGLLTTLWFFLLLVSYIVILSLPKSQAGEGRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPMDKAISVTFTVISPLLNPLIYTLRNHEMKSAMRR
LKRRLVPSDRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,245,709 59,245,709 SYN A/G K/K rs73482817 (DbSNP)
11 59,478,120 59,478,120 nonsense SNP G/T E/* 1000GP (CHBJPT)
11 100 -100 SYN C/T I/I 1000GP (YRI)
11 100 -100 NS G/A R/Q 1000GP (YRI, YRI)
11 100 -100 nonsense SNP G/T E/* 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I194T E231* % Freq CORP
1 I E 92.93 0.582
2 I * 6.45 1.200
3 T E 0.61 0.582

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4D10.aApr07-unspliced main_exon CDS chr11 59,477,430 59,478,362 +
3UTR chr11 59,478,362 59,478,365 +