Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D2 Olfactory Receptor

Gene Symbol OR4D21 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR17-24, AC005962-B, HsOR17.2.2, ORL3745
External Ids HGNC: 8294   GeneBank: AB065912, AF399568, BK004224   ORDB: ORL3745   
Build #39 labels OR4D2
Chromosomal location 17:58,169,656-58,170,576 (+)
Cluster 17@56
Synteny CLIC#40
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D1 79.87% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D2C 87% 298
Dog OR4D2 86% 298
Chimp CONTIG237.208-20896 98% 307
Mouse Or4d2 84% 304
Mouse Or4d2b 84% 307
Rat Or4d2 84% 304
Rat Or4d2b 84% 304
Cow OR4D2 83% 307
Cow OR4D2G 84% 307
Cow OR4D2B 82% 303
Cow OR4D2F 82% 307
Cow OR4D2D 81% 307
Cow OR4D2E 80% 307

Expression evidences

Source Accession
mRNA AB463963
GNF Atlas2 gnf1h07005_at

Sequence information

Nucleotide sequence ATGGAAACAGGGAACCTCACGTGGGTATCAGACTTTGTCTTCCTGGGGCTCTCGCAGACT
CGGGAGCTCCAGCGTTTCCTGTTTCTAATGTTCCTGTTTGTCTACATCACCACTGTTATG
GGAAACATCCTTATCATCATCACAGTGACCTCTGATTCCCAGCTCCACACACCCATGTAC
TTTCTGCTCCGAAACCTGGCTGTCCTAGACCTCTGTTTCTCTTCAGTCACTGCTCCCAAA
ATGCTAGTGGACCTCCTCTCTGAGAAGAAAACCATCTCTTACCAGGGCTGCATGGGTCAG
ATCTTCTTCTTCCACTTTTTGGGAGGTGCCATGGTCTTCTTCCTCTCAGTGATGGCCTTT
GACCGCCTCATTGCCATCTCCCGGCCCCTCCGCTATGTCACCGTCATGAACACTCAGCTC
TGGGTGGGGCTGGTGGTAGCCACCTGGGTGGGAGGCTTTGTCCACTCTATTGTCCAGCTG
GCTCTGATGCTCCCACTGCCCTTCTGTGGCCCCAACATTTTGGATAACTTCTACTGTGAT
GTTCCCCAAGTACTGAGACTTGCCTGCACTGACACCTCACTGCTGGAGTTCCTCAAGATC
TCCAACAGTGGGCTGCTGGATGTCGTCTGGTTCTTCCTCCTCCTGATGTCCTACTTATTC
ATCCTGGTGATGCTGAGGTCACATCCAGGGGAGGCAAGAAGGAAGGCAGCTTCCACCTGC
ACCACCCACATCATCGTGGTTTCCATGATCTTCGTTCCAAGCATTTACCTCTATGCCCGG
CCCTTCACTCCATTCCCTATGGACAAGCTTGTGTCCATCGGCCACACAGTCATGACCCCC
ATGCTCAACCCCATGATCTATACCCTGAGGAACCAGGACATGCAGGCAGCAGTGAGAAGA
TTAGGGAGACACCGGCTGGTT
Conceptual translation METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMY
FLLRNLAVLDLCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAF
DRLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCD
VPQVLRLACTDTSLLEFLKISNSGLLDVVWFFLLLMSYLFILVMLRSHPGEARRKAASTC
TTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTPMLNPMIYTLRNQDMQAAVRR
LGRHRLV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 100 -100 NS G/A R/Q 1000GP (YRI, YRI, YRI, YRI, YRI)
17 100 -100 SYN A/G V/V 1000GP (YRI, YRI)
17 56,247,078 56,247,078 NS A/G Q/R rs73323532 (DbSNP)
17 56,247,101 56,247,101 NS A/C I/L rs60994383 (DbSNP)
17 56,247,118 56,247,118 SYN C/G V/V rs35905234 (DbSNP)
17 56,247,454 56,247,454 SYN A/G V/V rs9912728 (DbSNP)
17 56,247,885 56,247,885 NS A/G K/R rs73993621 (DbSNP)
17 58,169,716 58,169,716 NS C/T R/W 1000GP (CHBJPT)
17 58,169,740 58,169,740 NS C/A L/I 1000GP (CEU, CHBJPT)
17 58,169,945 58,169,945 NS G/C C/S 1000GP (CEU)
17 58,170,093 58,170,093 SYN A/G V/V 1000GP (CEU)
17 58,170,214 58,170,214 NS C/T L/F 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 242 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R21W R21Q L29I C97S L187F A236S R260W T263A R290K % Freq CORP
1 R R L C L A R T R 67.13 0.050
2 R R I C L A R T R 18.43 0.050
3 R R L S F A R T R 8.45 0.817
4 R R I C L A R T K 3.15 0.050
5 R Q I C L A R T R 0.69 0.050
6 R R I C L S R T R 0.54 0.132
7 W R I C L A R T R 0.38 0.050
8 R R I C L A R A R 0.31 0.050
9 R R L C F A R T R 0.31 0.052
10 R R L S F A W T R 0.23 0.817
11 R R L S L A R T R 0.15 0.812
12 R R I S F A R T R 0.15 0.817
13 R R L C L A R T K 0.08 0.050

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4D2.aApr07-unspliced main_exon 5UTR chr17 58,169,426 58,169,656 +
CDS chr17 58,169,656 58,170,576 +
3UTR chr17 58,170,576 58,171,327 +