Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D6 Olfactory Receptor

Gene Symbol OR4D61 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR11-250, HsOR11.13.7, ORL3421
External Ids HGNC: 15175   GeneBank: AB065803, AF399569, BK004307, NM_001004708   ORDB: ORL3421   
Build #39 labels OR4D6
Chromosomal location 11:59,456,961-59,457,902 (+)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D10 64.63% 311
OR4D11 66.34% 309
OR4D9 67.96% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D6 88% 310
Chimp CONTIG466.5-25182 67% 309
Chimp CONTIG466.5-15588 66% 309
Chimp CONTIG466.3-7038 65% 308
Mouse Or4d6 88% 314
Rat Or4d6 88% 314
Cow OR4D6 83% 312

Expression evidences

Source Accession
mRNA BC137029

Sequence information

Nucleotide sequence ATGGACCAGATCAACCACACTAATGTGAAGGAGTTTTTCTTCCTGGAACTTACACGTTCC
CGAGAGCTGGAGTTTTTCTTGTTTGTGGTCTTCTTTGCTGTGTATGTAGCAACAGTCCTG
GGAAATGCACTCATTGTGGTCACTATTACCTGTGAGTCCCGCCTACACACTCCTATGTAC
TTTCTCCTGCGGAACAAATCAGTCCTGGACATCGTTTTTTCATCTATCACCGTCCCCAAG
TTCCTGGTGGATCTTTTATCAGACAGGAAAACCATCTCCTACAATGACTGCATGGCACAG
ATCTTTTTCTTCCACTTTGCTGGTGGGGCAGATATTTTTTTCCTCTCTGTGATGGCCTAT
GACAGATACCTTGCAATCGCCAAGCCCCTGCACTATGTGACCATGATGAGGAAAGAGGTG
TGGGTGGCCTTGGTGGTGGCTTCTTGGGTGAGTGGTGGTTTGCATTCAATCATCCAGGTA
ATTCTGATGCTTCCATTCCCCTTCTGTGGCCCCAACACACTGGATGCCTTCTACTGTTAT
GTGCTCCAGGTGGTAAAACTGGCCTGCACTGACACCTTTGCTTTGGAGCTTTTCATGATC
TCTAACAACGGACTGGTGACCCTGCTCTGGTTCCTCCTGCTCCTGGGCTCCTACACTGTC
ATTCTGGTGATGCTGAGATCCCACTCTGGGGAGGGGCGGAACAAGGCCCTCTCCACGTGC
ACGTCCCACATGCTGGTGGTGACTCTTCACTTCGTGCCTTGTGTTTACATCTACTGCCGG
CCCTTCATGACGCTGCCCATGGACACAACCATATCCATTAATAACACGGTCATTACCCCC
ATGCTGAACCCCATCATCTATTCCCTGAGAAATCAAGAGATGAAGTCAGCCATGCAGAGG
CTGCAGAGGAGACTTGGGCCTTCCGAGAGCAGAAAATGGGGG
Conceptual translation MDQINHTNVKEFFFLELTRSRELEFFLFVVFFAVYVATVLGNALIVVTITCESRLHTPMY
FLLRNKSVLDIVFSSITVPKFLVDLLSDRKTISYNDCMAQIFFFHFAGGADIFFLSVMAY
DRYLAIAKPLHYVTMMRKEVWVALVVASWVSGGLHSIIQVILMLPFPFCGPNTLDAFYCY
VLQVVKLACTDTFALELFMISNNGLVTLLWFLLLLGSYTVILVMLRSHSGEGRNKALSTC
TSHMLVVTLHFVPCVYIYCRPFMTLPMDTTISINNTVITPMLNPIIYSLRNQEMKSAMQR
LQRRLGPSESRKWG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,224,765 59,224,765 NS A/C D/A rs17500380 (DbSNP)
11 59,224,885 59,224,885 NS C/G T/S rs1453542 (DbSNP)
11 59,224,464 59,224,464 NS C/G Q/E rs17153766 (DbSNP)
11 59,224,738 59,224,738 NS C/T S/F rs17153770 (DbSNP)
11 59,224,608 59,224,608 NS G/A V/M rs1453544 (DbSNP)
11 59,224,720 59,224,720 NS G/A G/D rs1453543 (DbSNP)
11 59,225,221 59,225,221 NS T/C M/T rs1453541 (DbSNP)
11 59,457,292 59,457,292 NS A/C D/A 1000GP (CEU)
11 59,457,247 59,457,247 NS A/G D/G 1000GP (CEU, CHBJPT)
11 59,457,265 59,457,265 NS T/C F/S 1000GP (CEU, CHBJPT)
11 59,457,748 59,457,748 NS T/C M/T 1000GP (CEU, CHBJPT)
11 59,457,412 59,457,412 NS G/C S/T 1000GP (CEU, CHBJPT)
11 59,457,135 59,457,135 NS A/G M/V 1000GP (CEU, CHBJPT)
11 59,456,991 59,456,991 NS G/C E/Q 1000GP (CHBJPT)
11 59,457,657 59,457,657 NS C/T R/W 1000GP (CHBJPT)
11 100 -100 NS C/A F/L 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T L/L 1000GP (YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E11Q F13L R21Q M59V R64W S87L D96G F102S D111A S151T M224L V247M M263T V277I % Freq CORP
1 E F R M R S G F D S M V M V 58.91 0.641
2 E F R V R S G F D T M V T V 16.36 0.937
3 E F R M R S G S D S M V T V 6.14 0.641
4 E F R M R S D F D S M V M V 6.07 0.641
5 E F R M R S G F D T M V T V 3.38 0.641
6 Q F R M R S D F D S M V M V 2.76 0.641
7 E F R M R S G F A S M V M V 2.46 0.687
8 E F R M W S G S D S M M T V 0.61 0.766
9 E F R M R S G S D S L V T V 0.46 0.641
10 E F R V R S G F D S M V T V 0.38 0.937
11 E L R M R S G S D S M V T V 0.38 0.641
12 E F R M R S G S D T M V T V 0.31 0.641
13 E F R M R L G S D S M V T V 0.31 0.641
14 E F R M R S G F D T M V M V 0.31 0.641
15 E F R M R S D F D S M V M I 0.31 0.641
16 E F Q M R S G F D S M V M V 0.23 0.641
17 E F R V R S G F D T M V M V 0.15 0.937
18 E F R M R S G F D S M V T V 0.15 0.641
19 E F R M R S G S D S M V M V 0.15 0.641
20 Q F R M R S D F A S M V M V 0.08 0.687
21 E F R V R S G F D S M V M V 0.08 0.937

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4D6.aApr07-unspliced main_exon CDS chr11 59,456,961 59,457,902 +
3UTR chr11 59,457,902 59,457,905 +