Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4D8P Olfactory Receptor

Gene Symbol OR4D8P1 (View this gene in GeneCards)
Family 4
Subfamily D
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-246, HsOR11.13.9P, ORL3605
External Ids HGNC: 15177   GeneBank: AB065809, AF399441, BK004568, NG_004232   ORDB: ORL3605   
Build #39 labels OR4D8P
Chromosomal location 11:59,491,652-59,492,610 (+)
Cluster 11@59a
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4D10 91.72% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4D9C 87% 302
Chimp CONTIG466.5-3659 96% 320
Mouse Or4d10c 83% 300
Mouse Or4d10 85% 300
Mouse Or4d10b 84% 302
Rat Or4d11 80% 302
Rat Or4d10c 83% 300
Rat Or4d10 84% 300
Cow OR4D11 78% 302
Cow OR4D11B 81% 302
Cow OR4D31 80% 302

Sequence information

Nucleotide sequence ATGGAGATGAAAAACTGTACCAGGGTAAAAGAATTTATTTTCCTTGGCCTAACCCAGAAT
GGGGACACAAGATTGGTCCTATTTCTTTTCCTACTCTTGGTGTACATGACGACTCTGCTG
GGAAACCTCCTCATCATGGTCACTGTCACCTGTGAATCTTGCCTTCACATGCCCATGTAT
TTTTTGCTCCATAATTTATCTATTGCCGATATCTGCTTCTACTCCATCACAGAGCCCAAG
GTTCTGGTGGACCTTCTGTCTGAGAGAAAGACCATCTCCTTCAATGGTTGCTTCACTCAG
ATGTTTCTCTTCCACCTTATTGGAGGGGTGGATGCATTTTCTCTATCAGTGATGGCATTG
GATCAATATGTGGCCATTTCCAAGTCCCTGCACTATGCGACCATCATGAGTAGAGACCGT
TGCATTGGGCTCACAGTGGCTGCCTGGTTGGGGGGCTTTGTCCACTCCATTGTGCAGATT
ACCCTGTTGCTCCCACTCCCTTTCTGTGGACCAAATGTTCTTGACACTTTCTACTGTGAT
GTTCCCCAGGTTCTCAAACTCGCCCATACAGACATTTTCATACTTGAGCTGTTGATGATT
TCCAACAATGGACTGCTCACCACACTGTGGTTTTTCCTGCTCCTGGTGTCCTACATGGTC
ATATTATCATTACTCAAGTCTCAGGCAGGATAGGGCAGGAGGAAAGTCATCTCCACCTGC
ACCTCCCACATCACTGTGGTGACCCTGCATTTTGTGCCCTGCATCTATGTCTATGCCCGG
CCTTTCACTGCCCTCCCCACGGATAAGGCCATCTCTGTCACCTTCACTGTCATCTCCCCT
CTGCTCAACCCTTGATCTACACTCTGAGAAACCATGAGATGAAGTCAACCATGAAGAGAC
TGAAGACTCTGACCTTCTGATAGGAAATAGACCAGTGCTTCCCTCCTTCTCACCACTTT
Conceptual translation MEMKNCTRVKEFIFLGLTQNGDTRLVLFLFLLLVYMTTLLGNLLIMVTVTCESCLHMPMY
FLLHNLSIADICFYSITEPKVLVDLLSERKTISFNGCFTQMFLFHLIGGVDAFSLSVMAL
DQYVAISKSLHYATIMSRDRCIGLTVAAWLGGFVHSIVQITLLLPLPFCGPNVLDTFYCD
VPQVLKLAHTDIFILELLMISNNGLLTTLWFFLLLVSYMVILSLLKSQAGXRRKVISTC
TSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLL/PLIYTLRNHEMKSTMK
RLKTLTFXEIDQCFPPSHHF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 59,259,637 59,259,637 SNP A/C rs10896979 (DbSNP)
11 59,259,846 59,259,846 SNP C/T rs3862659 (DbSNP)
11 59,259,831 59,259,831 SNP C/T rs10896980 (DbSNP)
11 59,492,164 59,492,164 SNP A/C 1000GP (CEU, CHBJPT)
11 59,492,358 59,492,358 SNP T/C 1000GP (CEU, CHBJPT)
11 59,492,373 59,492,373 SNP C/T 1000GP (CEU)
11 59,492,314 59,492,314 SNP A/G 1000GP (CHBJPT)
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 59,259,025 59,262,083 CopyNumber #79 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.