Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4E2 Olfactory Receptor

Gene Symbol OR4E21 (View this gene in GeneCards)
Family 4
Subfamily E
Pseudogene No
CORP pseudogene probability score
Aliases OR14-42, AE000658-A, HsOR14.2.5, ORL3698
External Ids HGNC: 8297   GeneBank: AB065895, AF399581, AY726598, BK004526, NM_001001912   ORDB: ORL3698   
Build #39 labels OR4E2
Chromosomal location 14:21,665,083-21,666,021 (+)
Cluster 14@22b
Synteny CLIC#35
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs2874103)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4E1P 63.16% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4E2 83% 307
Chimp CONTIG1000.44-791 98% 313
Mouse Or4e2 86% 306
Rat Or4e2 86% 306
Cow OR4E2 86% 313

Expression evidences

Source Accession
mRNA AB463964
GNF Atlas2 gnf1h02184_at

Sequence information

Nucleotide sequence ATGGACAGTCTAAACCAAACAAGAGTGACTGAATTTGTCTTCTTGGGACTCACTGATAAC
CGGGTGCTGGAAATGCTGTTTTTCATGGCATTCTCAGCCATTTATATGCTAACGCTTTCA
GGGAACATTCTCATCATCATTGCCACAGTCTTTACTCCAAGTCTCCATACCCCCATGTAT
TTCTTCCTGAGCAATCTGTCCTTTATTGACATCTGCCACTCATCTGTCACTGTGCCTAAG
ATGTTGGAGGGTTTGCTTTTAGAAAGAAAGACCATTTCCTTTGACAACTGCATCACACAG
CTCTTCTTCCTACATCTCTTTGCCTGTGCCGAGATCTTTCTGCTGATCATTGTGGCGTAT
GATCGTTACGTGGCTATCTGCACTCCACTCCACTACCCCAATGTGATGAACATGAGAGTC
TGTATACAGCTTGTCTTTGCTCTCTGGTTGGGGGGTACTGTTCACTCACTAGGGCAGACC
TTCTTGACTATTCGTCTACCTTACTGTGGCCCCAACATTATTGACAGCTACTTCTGTGAT
GTGCCTCTTGTTATCAAGCTGGCCTGCACAGATACATACCTCACAGGAATACTGATTGTG
ACCAATAGTGGAACCATCTCCCTCTCCTGTTTCTTGGCCGTGGTCACCTCCTATATGGTC
ATCCTGGTTTCTCTTCGAAAACACTCAGCTGAAGGGCGCCAGAAAGCCCTGTCTACCTGC
TCGGCCCACTTCATGGTGGTTGCCCTCTTCTTTGGGCCATGTATCTTCATCTATACTCGG
CCAGACACCAGCTTCTCCATTGACAAGGTGGTGTCTGTCTTCTACACAGTGGTCACCCCT
TTGCTGAATCCCTTCATTTACACCTTGAGGAATGAGGAGGTAAAAAGTGCCATGAAGCAG
CTCAGGCAGAGACAAGTTTTTTTCACGAAATCATATACA
Conceptual translation MDSLNQTRVTEFVFLGLTDNRVLEMLFFMAFSAIYMLTLSGNILIIIATVFTPSLHTPMY
FFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCITQLFFLHLFACAEIFLLIIVAY
DRYVAICTPLHYPNVMNMRVCIQLVFALWLGGTVHSLGQTFLTIRLPYCGPNIIDSYFCD
VPLVIKLACTDTYLTGILIVTNSGTISLSCFLAVVTSYMVILVSLRKHSAEGRQKALSTC
SAHFMVVALFFGPCIFIYTRPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQ
LRQRQVFFTKSYT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS G/A V/M 1000GP (YRI, YRI, YRI, YRI)
14 100 -100 SYN A/G S/S 1000GP (YRI)
14 21,665,202 21,665,202 SYN A/G S/S 1000GP (CEU, CHBJPT)
14 21,665,412 21,665,412 SYN C/T A/A 1000GP (CEU)
14 21,665,434 21,665,434 NS G/A V/M 1000GP (CEU, CHBJPT)
14 21,665,685 21,665,685 SYN C/G T/T 1000GP (CEU)
14 21,665,783 21,665,783 NS A/G Q/R 1000GP (CEU, CHBJPT)
14 21,665,804 21,665,804 NS C/T S/L 1000GP (CEU)
14 22,133,416 22,133,416 SYN A/G S/S rs12717305 (DbSNP)
14 22,133,648 22,133,648 NS A/G M/V rs2874103 (DbSNP)
14 22,133,849 22,133,849 NS A/G I/V rs72686096 (DbSNP)
14 22,133,997 22,133,997 NS A/G Q/R rs970382 (DbSNP)
14 22,134,018 22,134,018 NS C/T S/L rs61732411 (DbSNP)
14 22,134,092 22,134,092 NS C/T P/S rs61732410 (DbSNP)
14 22,134,104 22,134,104 NS G/T V/L rs61732409 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 21,931,624 22,169,502 CopyNumber Variation_5318 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F12L N42H V118M R165H Q234R L237V S241L V270L % Freq CORP
1 F N M R R L S V 58.91 0.137
2 F N V R Q L S V 25.12 0.388
3 F N M R R L L V 14.52 0.137
4 L N M R R L S V 0.46 0.137
5 F N M R R L S L 0.46 0.137
6 F N M R Q L S V 0.15 0.137
7 F N V R R L S V 0.15 0.388
8 F N M R R V L V 0.08 0.224
9 F N M H R L S V 0.08 0.137
10 F H M R R L S V 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4E2.aApr07-unspliced main_exon CDS chr14 21,665,083 21,666,021 +
3UTR chr14 21,666,021 21,666,024 +