Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F15 Olfactory Receptor

Gene Symbol OR4F151 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR15-14, HsOR15.2.2, ORL3143
External Ids HGNC: 15078   GeneBank: AB065900, AF399573, AY284005-AY284036, BK004405, NM_001001674   ORDB: ORL3143   
Build #39 labels OR4F15
Chromosomal location 15:101,818,187-101,819,122 (+)
Cluster 15@102
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F14P 71.7% 311
OR4F1P 71.7% 311
OR4F2P 71.06% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 73% 311
Chimp CONTIG2193.6-4198 99% 312
Mouse Or4f15 86% 311
Rat Or4f15 84% 311
Cow OR4F15 84% 311

Expression evidences

Source Accession
mRNA BC137065
GNF Atlas2 gnf1h10666_at

Sequence information

Nucleotide sequence ATGAATGGAATGAATCACTCTGTGGTATCAGAATTTGTATTCATGGGACTCACCAACTCA
CGGGAGATTCAGCTTCTACTTTTTGTTTTCTCTTTGTTGTTCTACTTTGCGAGCATGATG
GGAAACCTTGTCATTGTATTCACTGTAACCATGGATGCTCATCTGCACTCCCCCATGTAT
TTCCTCCTGGCTAACCTCTCAATCATTGATATGGCATTTTGCTCAATTACAGCCCCTAAG
ATGATTTGTGATATTTTCAAGAAGCACAAGGCCATCTCCTTTCGGGGATGTATTACTCAG
ATCTTCTTTAGCCATGCTCTTGGGGGCACTGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGATACATGGCCATATGTAAACCTCTCCACTACCTGACCATCATGAGCCCAAGAATG
TGTCTATACTTTTTAGCCACTTCCTCTATCATTGGCCTTATCCACTCATTGGTCCAATTA
GTTTTTGTGGTAGATTTACCTTTTTGTGGTCCTAATATCTTTGACAGTTTTTACTGTGAT
CTCCCTCGGCTCCTCAGACTTGCCTGTACCAACACCCAAGAACTGGAGTTCATGGTCACT
GTCAATAGTGGACTCATTTCTGTGGGCTCCTTTGTCTTGCTGGTAATTTCCTACATCTTC
ATTCTGTTCACTGTTTGGAAACATTCTTCTGGTGGTCTAGCCAAGGCCCTCTCTACCCTG
TCAGCTCATGTCACTGTGGTCATCTTGTTCTTTGGGCCACTGATGTTTTTCTACACATGG
CCTTCTCCCACATCACACCTGGATAAATATCTTGCTATTTTTGATGCATTTATTACTCCT
TTTCTGAATCCAGTTATCTACACATTCAGGAACAAAGACATGAAAGTGGCAATGAGGAGA
CTGTGCAGTCGTCTTGCGCATTTTACAAAGATTTTG
Conceptual translation MNGMNHSVVSEFVFMGLTNSREIQLLLFVFSLLFYFASMMGNLVIVFTVTMDAHLHSPMY
FLLANLSIIDMAFCSITAPKMICDIFKKHKAISFRGCITQIFFSHALGGTEMVLLIAMAF
DRYMAICKPLHYLTIMSPRMCLYFLATSSIIGLIHSLVQLVFVVDLPFCGPNIFDSFYCD
LPRLLRLACTNTQELEFMVTVNSGLISVGSFVLLVISYIFILFTVWKHSSGGLAKALSTL
SAHVTVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKDMKVAMRR
LCSRLAHFTKIL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 100 -100 NS G/A A/T 1000GP (YRI)
15 101,818,591 101,818,591 NS C/G I/M 1000GP (CEU)
15 101,819,000 101,819,000 NS G/A A/T 1000GP (CEU)
15 102,358,450 102,358,450 NS C/T R/W rs61737700 (DbSNP)
15 102,358,523 102,358,523 NS C/T T/I rs61737907 (DbSNP)
15 102,358,677 102,358,677 SYN A/C G/G rs61737898 (DbSNP)
15 102,358,835 102,358,835 NS C/T S/F rs61737725 (DbSNP)
15 102,358,939 102,358,939 NS C/T L/F rs61739201 (DbSNP)
15 102,359,307 102,359,307 SYN A/G A/A rs12324219 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 49 (Hasin)
15 101,991,277 102,393,237 CopyNumber Variation_34506 (DGV)
15 102,036,377 102,393,237 CopyNumber Variation_8808 (DGV)
15 102,271,630 102,431,074 CopyNumber Variation_3985 (DGV)
15 102,277,237 102,431,074 CopyNumber Variation_2202 (DGV)
15 102,305,129 102,393,477 CopyNumber Variation_8809 (DGV)
15 102,358,290 102,361,325 CopyNumber #92 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R21Q I45T R95Q Y143* S149F L184F A272T D293E % Freq CORP
1 R I R Y S L A D 92.93 0.283
2 R I R Y S L T D 5.53 0.283
3 R I Q Y S L A D 0.46 0.283
4 R I R * S L A D 0.31 1.200
5 R T R Y S L A D 0.31 0.144
6 R I R Y F L A D 0.23 0.283
7 R I R Y S F T D 0.08 0.283
8 Q I R Y S L A D 0.08 0.283
9 R I R Y S L A E 0.08 0.283

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F15.aApr07-unspliced main_exon CDS chr15 101,818,187 101,819,122 +
3UTR chr15 101,819,122 101,819,125 +