Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F16 Olfactory Receptor

Gene Symbol OR4F161 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.58 (pseudogene)
Aliases OR1-1, OR7-21, ORL3141
External Ids HGNC: 15079   GeneBank: BK004219, BK004481, NM_001005221, NM_001005224, NM_001005277   ORDB: ORL3141   
Build #39 labels OR4F16
Chromosomal location 1:685,719-686,654 (-)
Cluster 1@1
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F21 99.04% 312
OR4F29 100% 312
OR4F3 100% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 91% 312
Chimp CONTIG5079.3-2008 97% 312
Chimp CONTIG4060.3-4296 97% 312
Chimp CONTIG9284.2-1002 96% 312
Mouse Or4f7 82% 312
Rat Or4f7 83% 312
Rat Or4f7b 83% 312
Rat Or4f7c 82% 312
Cow OR4F1 90% 312
Cow OR4F1D 87% 312
Cow OR4F1C 88% 309

Expression evidences

Source Accession
ESTs CF552435
mRNA BC137568

Sequence information

Nucleotide sequence ATGGATGGAGAGAATCACTCAGTGGTATCTGAGTTTTTGTTTCTGGGACTCACTCATTCA
TGGGAGATCCAGCTCCTCCTCCTAGTGTTTTCCTCTGTGCTCTATGTGGCAAGCATTACT
GGAAACATCCTCATTGTGTTTTCTGTGACCACTGACCCTCACTTACACTCCCCCATGTAC
TTTCTACTGGCCAGTCTCTCCTTCATTGACTTAGGAGCCTGCTCTGTCACTTCTCCCAAG
ATGATTTATGACCTGTTCAGAAAGCGCAAAGTCATCTCCTTTGGAGGCTGCATCGCTCAA
ATCTTCTTCATCCACGTCGTTGGTGGTGTGGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGATATGTGGCCCTATGTAAGCCCCTCCACTATCTGACCATTATGAGCCCAAGAATG
TGCCTTTCATTTCTGGCTGTTGCCTGGACCCTTGGTGTCAGTCACTCCCTGTTCCAACTG
GCATTTCTTGTTAATTTAGCCTTCTGTGGCCCTAATGTGTTGGACAGCTTCTACTGTGAC
CTTCCTCGGCTTCTCAGACTAGCCTGTACCGACACCTACAGATTGCAGTTCATGGTCACT
GTTAACAGTGGGTTTATCTGTGTGGGTACTTTCTTCATACTTCTAATCTCCTACGTCTTC
ATCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGTTCATCCAAGGCCCTTTCCACTCTT
TCAGCTCACAGCACAGTGGTCCTTTTGTTCTTTGGTCCACCCATGTTTGTGTATACACGG
CCACACCCTAATTCACAGATGGACAAGTTTCTGGCTATTTTTGATGCAGTTCTCACTCCT
TTTCTGAATCCAGTTGTCTATACATTCAGGAATAAGGAGATGAAGGCAGCAATAAAGAGA
GTATGCAAACAGCTAGTGATTTACAAGAGGATCTCA
Conceptual translation MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAF
DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD
LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL
SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR
VCKQLVIYKRIS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber 190 (Hasin)
1 10,377 998,287 CopyNumber Variation_3274 (DGV)
1 87,959 1,018,704 CopyNumber Variation_2294 (DGV)
1 356,214 633,476 CopyNumber Variation_31594 (DGV)
1 356,623 688,990 CopyNumber Variation_74278 (DGV)
1 521,413 710,845 CopyNumber Variation_69577 (DGV)
1 539,255 656,750 CopyNumber Variation_4190 (DGV)
1 564,477 706,368 CopyNumber Variation_37560 (DGV), Variation_37599 (DGV)
1 579,492 743,311 CopyNumber Variation_4191 (DGV)
1 586,355 659,973 CopyNumber Variation_69571 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
7tm_1.15.aApr07-unspliced main_exon 3UTR chr1 685,716 685,719 -
CDS chr1 685,719 686,654 -
5UTR chr1 686,654 687,453 -