Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F17 Olfactory Receptor

Gene Symbol OR4F171 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.14 (functional)
Aliases HsOR19.1.3, ORL3343
External Ids HGNC: 15381   GeneBank: AB065917, NM_001004195, NM_001005240   ORDB: ORL3343   
Build #39 labels OR4F17, OR4F11P, OR4F18, OR4F19
Chromosomal location 19:110,679-111,593 (+)
Cluster 19@0
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F4 99.02% 305
OR4F5 99.02% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F26 78% 304
Chimp CONTIG1760.9-5104 98% 305
Mouse Or4f4-ps 84% 298
Mouse Or4f17-ps 83% 298
Mouse Or4f4b 82% 297
Rat Or4f4b-ps 82% 297
Cow OR4F4 85% 303

Expression evidences

Source Accession
mRNA BC136908

Sequence information

Nucleotide sequence ATGGTGACTGAATTCATTTTTCTGGGTCTCTCTGATTCTCAGGGACTCCAGACCTTCCTA
TTTATGTTGTTTTTTGTATTCTATGGAGGAATCGTGTTTGGAAACCTTCTTATTGTCATA
ACAGTGGTATCTGACTCCCACCTTCACTCTCCCATGTACTTCCTGCTAGCCAACCTCTCA
CTCATTGATCTGTCTCTGTCTTCAGTCACAGCCCCCAAGATGATTACTGACTTTTTCAGC
CAGCGCAAAGTCATCTCTTTCAAGGGCTGCCTTGTTCAGATATTTCTCCTTCACTTCTTT
GGTGGGAGTGAGATGGTGATCCTCATAGCCATGGGCTTTGACAGATATATAGCAATATGC
AAACCCCTACACTACACTACAATTATGTGTGGCAACGCATGTGTCGGCATTATGGCTGTC
GCATGGGGAATTGGCTTTCTCCATTCGGTGAGCCAGTTGGCCTTTGCCGTGCACTTACCC
TTCTGTGGTCCCAATGAGGTCGATAGTTTTTATTGTGACCTTCCTAGGGTAATCAAACTT
GCCTGTACAGATACCTACAGGCTAGATATTATGGTCATTGCTAACAGTGGTGTGCTCACT
GTGTGTTCTTTTGTTCTTCTAATCATCTCATACACTATCATCCTAATGACCATCCAGCAT
CGCCCTTTAGATAAGTCGTCCAAAGCTCTGTCCACTTTGACTGCTCACATTACAGTAGTT
CTTTTGTTCTTTGGACCATGTGTCTTTATTTATGCCTGGCCATTCCCCATCAAGTCATTA
GATAAATTCCTTGCTGTATTTTATTCTGTGATCACCCCTCTCTTGAACCCAATTATATAC
ACACTGAGGAACAAAGACATGAAGACGGCAATAAGACAGCTGAGAAAATGGGATGCACAT
TCTAGTGTAAAGTTT
Conceptual translation MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH
SSVKF

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
19 60,354 168,972 CopyNumber Variation_30879 (DGV)
19 60,070 172,370 CopyNumber Variation_73240 (DGV)
19 60,070 243,098 CopyNumber Variation_73242 (DGV)
19 60,179 119,175 CopyNumber Variation_78021 (DGV), Variation_89026 (DGV)
19 89,677 123,389 CopyNumber Variation_78022 (DGV)
19 89,677 165,529 CopyNumber Variation_78024 (DGV)
19 89,677 119,175 CopyNumber Variation_89027 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F17.aApr07 exon_5UTR chr19 107,146 107,157 +
main_exon 5UTR chr19 110,625 110,679 +
CDS chr19 110,679 111,593 +
3UTR chr19 111,593 111,596 +