Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F3 Olfactory Receptor

Gene Symbol OR4F31 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score
Aliases OR1-1, AC004908, OR7-21
External Ids HGNC: 8300   GeneBank: BK004219, BK004481, NM_001005221, NM_001005224, NM_001005277   
Build #39 labels OR4F3
Chromosomal location 5:181,367,287-181,368,222 (+)
Cluster 5@181b
Synteny CLIC#11
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F16 100% 312
OR4F21 99.04% 312
OR4F29 100% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 91% 312
Chimp CONTIG5079.3-2008 97% 312
Chimp CONTIG4060.3-4296 97% 312
Chimp CONTIG9284.2-1002 96% 312
Mouse Or4f7 82% 312
Rat Or4f7 83% 312
Rat Or4f7b 83% 312
Rat Or4f7c 82% 312
Cow OR4F1 90% 312
Cow OR4F1D 87% 312
Cow OR4F1C 88% 309

Expression evidences

Source Accession
mRNA BC137568

Sequence information

Nucleotide sequence ATGGATGGAGAGAATCACTCAGTGGTATCTGAGTTTTTGTTTCTGGGACTCACTCATTCA
TGGGAGATCCAGCTCCTCCTCCTAGTGTTTTCCTCTGTGCTCTATGTGGCAAGCATTACT
GGAAACATCCTCATTGTGTTTTCTGTGACCACTGACCCTCACTTACACTCCCCCATGTAC
TTTCTACTGGCCAGTCTCTCCTTCATTGACTTAGGAGCCTGCTCTGTCACTTCTCCCAAG
ATGATTTATGACCTGTTCAGAAAGCGCAAAGTCATCTCCTTTGGAGGCTGCATCGCTCAA
ATCTTCTTCATCCACGTCGTTGGTGGTGTGGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGATATGTGGCCCTATGTAAGCCCCTCCACTATCTGACCATTATGAGCCCAAGAATG
TGCCTTTCATTTCTGGCTGTTGCCTGGACCCTTGGTGTCAGTCACTCCCTGTTCCAACTG
GCATTTCTTGTTAATTTAGCCTTCTGTGGCCCTAATGTGTTGGACAGCTTCTACTGTGAC
CTTCCTCGGCTTCTCAGACTAGCCTGTACCGACACCTACAGATTGCAGTTCATGGTCACT
GTTAACAGTGGGTTTATCTGTGTGGGTACTTTCTTCATACTTCTAATCTCCTACGTCTTC
ATCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGTTCATCCAAGGCCCTTTCCACTCTT
TCAGCTCACAGCACAGTGGTCCTTTTGTTCTTTGGTCCACCCATGTTTGTGTATACACGG
CCACACCCTAATTCACAGATGGACAAGTTTCTGGCTATTTTTGATGCAGTTCTCACTCCT
TTTCTGAATCCAGTTGTCTATACATTCAGGAATAAGGAGATGAAGGCAGCAATAAAGAGA
GTATGCAAACAGCTAGTGATTTACAAGAGGATCTCA
Conceptual translation MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAF
DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD
LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL
SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR
VCKQLVIYKRIS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
5 180,782,827 180,888,286 CopyNumber Variation_32766 (DGV)
5 180,711,229 180,830,475 CopyNumber Variation_64404 (DGV)
5 180,779,372 180,832,096 CopyNumber Variation_69275 (DGV)
5 180,776,968 180,896,486 CopyNumber Variation_69279 (DGV)
5 180,698,992 180,889,308 CopyNumber Variation_81175 (DGV)
5 180,784,440 180,889,308 CopyNumber Variation_81176 (DGV)
CopyNumber 199 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F16.aApr07-unspliced main_exon 5UTR chr5 181,366,488 181,367,287 +
CDS chr5 181,367,287 181,368,222 +
3UTR chr5 181,368,222 181,368,225 +