Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F5 Olfactory Receptor

Gene Symbol OR4F51 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.14 (functional)
Aliases HsOR1.1.3
External Ids HGNC: 14825   GeneBank: AB065592, NM_001005484   
Build #39 labels OR4F5
Chromosomal location 1:69,091-70,005 (+)
Cluster 1@0a
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F17 99.02% 305
OR4F4 98.69% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F26P 78% 304
Mouse Or4f4-ps 83% 298
Mouse Or4f17-ps 82% 298
Mouse Or4f4b 81% 297
Rat Or4f4b-ps 82% 297
Cow OR4F4 85% 303
Orang OR4F4 95% 284
Orang OR4F17P 95% 278
Horse OR4F17B 83% 305
Horse OR4F17 82% 305
Chimp OR4F4P 98% 302

Sequence information

Nucleotide sequence ATGGTGACTGAATTCATTTTTCTGGGTCTCTCTGATTCTCAGGAACTCCAGACCTTCCTA
TTTATGTTGTTTTTTGTATTCTATGGAGGAATCGTGTTTGGAAACCTTCTTATTGTCATA
ACAGTGGTATCTGACTCCCACCTTCACTCTCCCATGTACTTCCTGCTAGCCAACCTCTCA
CTCATTGATCTGTCTCTGTCTTCAGTCACAGCCCCCAAGATGATTACTGACTTTTTCAGC
CAGCGCAAAGTCATCTCTTTCAAGGGCTGCCTTGTTCAGATATTTCTCCTTCACTTCTTT
GGTGGGAGTGAGATGGTGATCCTCATAGCCATGGGCTTTGACAGATATATAGCAATATGC
AAGCCCCTACACTACACTACAATTATGTGTGGCAACGCATGTGTCGGCATTATGGCTGTC
ACATGGGGAATTGGCTTTCTCCATTCGGTGAGCCAGTTGGCGTTTGCCGTGCACTTACTC
TTCTGTGGTCCCAATGAGGTCGATAGTTTTTATTGTGACCTTCCTAGGGTAATCAAACTT
GCCTGTACAGATACCTACAGGCTAGATATTATGGTCATTGCTAACAGTGGTGTGCTCACT
GTGTGTTCTTTTGTTCTTCTAATCATCTCATACACTATCATCCTAATGACCATCCAGCAT
CGCCCTTTAGATAAGTCGTCCAAAGCTCTGTCCACTTTGACTGCTCACATTACAGTAGTT
CTTTTGTTCTTTGGACCATGTGTCTTTATTTATGCCTGGCCATTCCCCATCAAGTCATTA
GATAAATTCCTTGCTGTATTTTATTCTGTGATCACCCCTCTCTTGAACCCAATTATATAC
ACACTGAGGAACAAAGACATGAAGACGGCAATAAGACAGCTGAGAAAATGGGATGCACAT
TCTAGTGTAAAGTTT
Conceptual translation MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVTWGIGFLHSVSQLAFAVHLLFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH
SSVKF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 69,552 69,552 SYN C/G A/A rs55874132 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 211 (Hasin)
1 10,377 998,287 CopyNumber Variation_3274 (DGV)
1 10,499 91,591 CopyNumber Variation_68172 (DGV)
1 10,499 177,368 CopyNumber Variation_68173 (DGV)
1 11,516 84,611 CopyNumber Variation_83988 (DGV)
1 11,516 89,484 CopyNumber Variation_74276 (DGV)
1 11,516 250,293 CopyNumber Variation_74274 (DGV), Variation_83989 (DGV)
1 11,931 125,961 CopyNumber Variation_30360 (DGV)
1 27,982 177,346 CopyNumber Variation_0675 (DGV), Variation_2041 (DGV)
1 35,881 84,611 CopyNumber Variation_83987 (DGV)
1 35,881 89,484 CopyNumber Variation_74275 (DGV)
1 40,761 69,992 CopyNumber Variation_83990 (DGV)
1 55,394 86,303 CopyNumber Variation_0991 (DGV)
1 60,246 84,611 CopyNumber Variation_83991 (DGV)
1 66,008 79,078 CopyNumber Variation_1534 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T141A % Freq CORP
1 T 81.03 0.298
2 A 18.97 0.298

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F5.aApr07-unspliced main_exon CDS chr1 69,091 70,005 +
3UTR chr1 70,005 70,008 +