Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F6 Olfactory Receptor

Gene Symbol OR4F61 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.84 (pseudogene)
Aliases OR15-15, HsOR15.2.1
External Ids HGNC: 15372   GeneBank: AB065899, AF282018, BK004367, NM_001005326   
Build #39 labels OR4F6
Chromosomal location 15:101,805,720-101,806,655 (+)
Cluster 15@102
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F13P 69.03% 310
OR4F14P 72.73% 308
OR4F15 70.74% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F25 70% 311
Chimp CONTIG2193.6-16689 99% 312
Mouse Or4f6 85% 311
Rat Or4f6 84% 311
Cow OR4F70 76% 311

Expression evidences

Source Accession
mRNA BC137003
GNF Atlas2 gnf1h10878_at

Sequence information

Nucleotide sequence ATGGATGAAGCCAATCACTCTGTGGTCTCTGAGTTTGTGTTCCTGGGACTCTCTGACTCG
CGGAAGATCCAGCTCCTCCTCTTCCTCTTTTTCTCAGTGTTCTATGTGTCAAGCCTGATG
GGAAATCTCCTCATTGTGCTAACTGTGACCTCTGACCCTCGTTTACAGTCCCCCATGTAC
TTCCTGCTGGCCAACCTTTCCATCATCAATTTGGTATTTTGTTCCTCCACAGCTCCCAAG
ATGATTTATGACCTTTTCAGGAAGCACAAGACCATCTCTTTTGGGGGCTGTGTAGTTCAG
ATCTTCTTTATCCATGCAGTTGGGGGAACTGAGATGGTGCTGCTCATAGCCATGGCTTTT
GACCGATATGTGGCCATATGTAAGCCTCTCCACTACCTGACCATCATGAACCCACAAAGG
TGCATTTTGTTTTTAGTCATTTCCTGGATTATAGGTATTATTCACTCAGTGATTCAGTTG
GCTTTTGTTGTAGACCTGCTGTTCTGTGGCCCTAATGAATTAGATAGTTTCTTTTGTGAT
CTTCCTCGATTTATCAAACTGGCTTGCATAGAGACCTACACATTGGGATTCATGGTTACT
GCCAATAGTGGATTTATTTCTCTGGCTTCTTTTTTAATTCTCATAATCTCTTACATCTTT
ATTTTGGTGACTGTTCAGAAAAAATCTTCAGGTGGTATATTCAAGGCTTTCTCTATGCTG
TCAGCTCATGTCATTGTGGTGGTTTTGGTCTTTGGGCCATTAATCTTTTTCTATATTTTT
CCATTTCCCACATCACATCTTGATAAATTCCTTGCCATCTTTGATGCAGTTATCACTCCC
GTTTTGAATCCAGTCATCTATACTTTTAGAAATAAAGAGATGATGGTGGCAATGAGAAGA
CGATGCTCTCAGTTTGTGAATTACAGTAAAATCTTT
Conceptual translation MDEANHSVVSEFVFLGLSDSRKIQLLLFLFFSVFYVSSLMGNLLIVLTVTSDPRLQSPMY
FLLANLSIINLVFCSSTAPKMIYDLFRKHKTISFGGCVVQIFFIHAVGGTEMVLLIAMAF
DRYVAICKPLHYLTIMNPQRCILFLVISWIIGIIHSVIQLAFVVDLLFCGPNELDSFFCD
LPRFIKLACIETYTLGFMVTANSGFISLASFLILIISYIFILVTVQKKSSGGIFKAFSML
SAHVIVVVLVFGPLIFFYIFPFPTSHLDKFLAIFDAVITPVLNPVIYTFRNKEMMVAMRR
RCSQFVNYSKIF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 100 -100 NS A/G K/E 1000GP (YRI, YRI)
15 100 -100 SYN G/A V/V 1000GP (YRI, YRI)
15 101,805,880 101,805,880 NS G/A R/H 1000GP (CEU)
15 101,806,140 101,806,140 NS T/G C/G 1000GP (CHBJPT)
15 102,346,030 102,346,030 SYN A/G V/V rs401632 (DbSNP)
15 102,346,083 102,346,083 NS A/G H/R rs61746768 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
15 101,991,277 102,393,237 CopyNumber Variation_34506 (DGV)
15 102,036,377 102,393,237 CopyNumber Variation_8808 (DGV)
15 102,197,455 102,352,490 CopyNumber Variation_0193 (DGV)
15 102,271,630 102,431,074 CopyNumber Variation_3985 (DGV)
15 102,277,237 102,431,074 CopyNumber Variation_2202 (DGV)
15 102,305,129 102,393,477 CopyNumber Variation_8809 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R54C R54H I101M C141G % Freq CORP
1 R R I C 97.93 0.939
2 R R I G 0.77 0.939
3 R H I C 0.61 0.939
4 R R M C 0.46 0.939
5 C R I C 0.23 0.939

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F6.aApr07-unspliced main_exon CDS chr15 101,805,720 101,806,655 +
3UTR chr15 101,806,655 101,806,658 +