Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F7P Olfactory Receptor

Gene Symbol OR4F7P1 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene Yes
CORP pseudogene probability score
Aliases ORL3189
External Ids HGNC: 15089   ORDB: ORL3189   
Build #39 labels OR4F7P, OR4F10
Chromosomal location 6:170,639,606-170,640,528 (+)
Cluster 6@171
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F1P 99.35% 308
OR4F2P 99.03% 308
OR4F8P 99.03% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 91% 308
Mouse Or4f7 82% 308
Rat Or4f7b 83% 308
Rat Or4f7 83% 308
Rat Or4f7c 82% 308
Cow OR4F1 90% 308
Cow OR4F1C 88% 306
Cow OR4F1D 88% 308
Orang OR4F58BP 73% 308
Horse OR4F1 91% 308
Chimp OR4F21 97% 308
Chimp OR4F1 96% 308
Chimp OR4F21BP 95% 306

Sequence information

Nucleotide sequence ATGGATGGAGAGAATCACTCAGTGGTATCTGAGTTTTTGTTTCTGGGACTCACTCATTCA
TGGGAGATCCAGCTCCTCCTCCTAGTGTTTTCCTCTGTGCTCTATGTGGCAAGCATTACT
GGAAACATCCTCATTGTGTTTTCTGTGACCACTGACCCTCACTTACACTCCCCCATGTAC
TTTCTACTGGCCAGTCTCTCCTTCATTGACTTAGGAGCCTGCTCTGTCACTTCTCCCAAG
ATGATTTATGACCTGTTCAGAAAGCGCAAAGTCATCTCCTTTGGAGGCTGCATCGCTCAA
ATCTTCTTCATCCACGTCATTGGTGGTGTGGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGTTATGTGGCCCTATTAAGCCCCTCCACTATCTGACCATTATGAGCCCAAGAATGT
GCCTTTCATTTCTGGCTGTTGCCTGGACCCTTGGTGTCAGTCACTCCCTGTTCCAACTGG
CATTTCTTGTTAATTTACCCTTCTGTGGCCCTAATGTGTTGGACAGCTTCTACTGTGACC
TTCCTCAGCTTCTCAGACTAGCCTGTACCGACACCTACAGATTGCAGTTCATGGTCACTG
TTAACAGTGGGTTTATCTGTGTGGGTACTTTCTTCATACTTCTAATCTCCTACATCTTCA
TCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGTTCATCCAAGGCCCTTTCCACTCTTT
CAGCTCACAGCACAGCGGTCCTTTTGTTCTTTGGTCCACCCATGTTTGTGTATACATGGC
CACACCCTAATTCACAGATGGACAAGTTTCTGGCTATTTTTGATGCAGTTCTCACTCCTT
TTCTGAATCCAGTTGTCTATACATTCAGGAATAAGGAGATGAAGGCAGCAATAAAGAGAG
TATGCAAACAGCTAGTGATTTAC
Conceptual translation MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF
DSYVAL/KPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLPFCGPNVLDSFYC
DLPQLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYIFILFTVWKHSSGGSSKALST
LSAHSTAVLLFFGPPMFVYTWPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIK
RVCKQLVIY

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
6 170,821,217 171,009,919 CopyNumber Variation_3658 (DGV)
6 170,911,102 171,043,083 CopyNumber Variation_94306 (DGV)
6 170,931,498 170,990,405 CopyNumber Variation_69722 (DGV)
6 170,934,886 171,055,036 CopyNumber Variation_69721 (DGV)
6 170,937,231 171,043,914 CopyNumber Variation_32856 (DGV)
6 170,938,048 170,951,512 CopyNumber Variation_94307 (DGV)
6 170,939,053 171,025,493 CopyNumber Variation_7549 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.