Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F8P Olfactory Receptor

Gene Symbol OR4F8P1 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR19.1.4P, ORL3783
External Ids HGNC: 15395   GeneBank: NG_004359, NG_004682   ORDB: ORL3783   
Build #39 labels OR4F8P, OR4F20P, OR4F9P
Chromosomal location 19:156,282-157,216 (-)
Cluster 19@0
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F1P 98.4% 312
OR4F2P 98.08% 312
OR4F7P 99.03% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 90% 312
Mouse Or4f7 81% 312
Rat Or4f7 82% 312
Rat Or4f7b 82% 312
Rat Or4f7c 81% 312
Cow OR4F1 89% 312
Cow OR4F1D 87% 312
Cow OR4F1C 87% 309
Orang OR4F58BP 72% 309
Horse OR4F1 90% 312
Chimp OR4F21 96% 312
Chimp OR4F1 96% 312
Chimp OR4F21BP 95% 310

Sequence information

Nucleotide sequence ATGGATGGAGAGAATCACTCAGTGGTATCTGAGTTTTTGTTTCTGGGACTCACTCATTCA
TGGGAGATCCAGCTCCTCCTCCTAGTGTTTTCCTCTGTGCTCTATGTGGCAAGCATTACT
GGAAACATCCTCATTGTGTTTTCTGTGACCACTGACCCTCACTTACACTCCCCCATGTAC
TTTCTACTGGTCAGTCTCTCCTTCATTGACTTAGGAGCCTGCTCTGTCACTTCTCCCAAG
ATGATTTATGACCTGTTCAGAAAGCGCAAAGTCATCTCCTTTGGAGGCTGCATCGCTCAA
ATCTTCTTCATCCACGTCATTGGTGGTGTGGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGTTATGTGGCCCTATTAAGCCCCTCCACTATCTGACCATTATGAGCCCAAGAATGT
GCCTTTCATTTCTGGCTGTTGCCTGGACCCTTGTTGTCAGTCACTCCCTGTTCCAACTGG
CATTTCTTGTTAATTTACCCTTCTGTGGCCCTAATGTGTTGGACAGCTTCTACTGTGACC
TTCCTCAGCTTCTCAGACTAGCCTGTACCGACACCTACAGATTGCAGTTCATGGTCACTG
TTAACAGTGGGTTTATCTGTGTGGGTACTTTCTTCATACTTCTAATCTCCTACGTCTTCA
TCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGTTCATCCAAGGCCCTTTCCACTCTTT
CAGCTCACAGCACAGCGGTCCTTTTGTTCTTTGGTCCACCCATGTTTGTGTATACATGGC
CACACCCTAATTCACAGATGGACAAGTTTCTGGCTATTTTTGATGCAGTTCTCACTCCTT
TTCTGAATCCAGTTGTCTATACATTCAGGAATAAGGAGATGAAGGCAGCAATAAAGAGAG
TATGCAAACAGCTAGTGATTTACAAGAAGATCTCA
Conceptual translation MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY
FLLVSLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF
DSYVAL/KPLHYLTIMSPRMCLSFLAVAWTLVVSHSLFQLAFLVNLPFCGPNVLDSFYC
DLPQLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALST
LSAHSTAVLLFFGPPMFVYTWPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIK
RVCKQLVIYKKIS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 157,003 157,003 SNP C/T rs55816419 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 60,354 168,972 CopyNumber Variation_30879 (DGV)
19 128,306 168,972 CopyNumber Variation_32226 (DGV)
19 60,070 172,370 CopyNumber Variation_73240 (DGV)
19 60,070 243,098 CopyNumber Variation_73242 (DGV)
19 122,887 172,370 CopyNumber Variation_73243 (DGV)
19 89,677 165,529 CopyNumber Variation_78024 (DGV)
CopyNumber 228 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.