Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4H6P Olfactory Receptor

Gene Symbol OR4H6P1 (View this gene in GeneCards)
Family 4
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR14-58, OR4-114, OR4-115, OR4-119, OR15-9, OR15-69, OR15-80, OR15-81, OR15-71, OR15-82, OR5-39, OR5-84, HsOR15.1.7P, ORL3729
External Ids HGNC: 8312   GeneBank: AF399449, BK004753, NG_002307   ORDB: ORL3729   
Build #39 labels OR4H6P, OR4H10P, OR4H5P, OR4H11P, OR4H8P
Chromosomal location 15:22,056,709-22,057,639 (+)
Cluster 15@22
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4H12P 92.12% 292

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4H12 88% 309
Dog OR4H12B 87% 289
Mouse Or4s2b 60% 311
Rat Or4s2 60% 305
Cow OR4H12 84% 292
Orang OR4H12P 93% 311
Orang OR4H12B 92% 312
Orang OR4H12CP 92% 311
Orang OR4H12DP 91% 196
Horse OR4H12 88% 312
Chimp OR4S2 59% 311

Sequence information

Nucleotide sequence ATGAAAGTGGCCAACAATGTCACTGAGTTTATATTCCTGGGACTTTCCCAAGATTCTGGA
ATGCAATTGATGTTCTTTGTCTTATTTCTCCTCTTCTACGTCGTGATCATGGTGGGAAAT
TTGCTCATTTTGCTTATGGTCTTTTCTGACTCCCGACTACACACACCCATGTATTTCTTC
CTCAGTAACCTGTCTTTTGTGGACATTGCCTATTCCTCACCCACAGCACCCAAGATGATT
GAAGACTTTGTTTCTGAGAAAAAGACTATTTCCTACTGGGGCTGTATAACTTAGATGTTT
ACCTTCCACTTTTTTGGTTGTGCTGAGATTTTTGTTTTGACTGTCATGGCTTTTGATCGC
TATGCTGCTATCTGCCAATCCCTCCGTTACACTGTCATCATGAGTGCTAATGCTTATACT
GTGCTGGCATCACTGTCCTGGTTGGGGGCCCTGGGTCATTCCTTTGTTCAGACCCTCCTG
ACCTTCCAGCTGCCCTTCTGTAATGCTCAGGTTATAGACCATTACTTTTGTGATGTCCAC
CCAGTCCTAAAACTTGCCTGTGCTGATACAACTCTGGTAAATATGTTGGTGGTTGCCAAC
AGTGGTCTCATCTCCCTGGGGTGTTTCCTCATTCTTTTGGCCTCCTACACAGTCATTCTG
TTTAGTCTTCAAAAACAGTCTGCAGAGAGCTGACACAAAGTTCTCTCTACCTGTGGATCT
CATCTGACTATAGTAACTTTCTTCTTTGTTCCGTGTATCTTTATTTATCTCCATCCACTA
CTTTCCCATTGGATAAAGCTGTGTCTGTGTTCTATACCACCATCACCCCAATGCTGAACC
CACTCATCTATACTCTGAGGAATGAGGAGTAAAGAATGCCATGAGGCGGCTATGGAGTAG
CAAGATCTCCTTGAAGGAAAAGCAGAGAGGA
Conceptual translation MKVANNVTEFIFLGLSQDSGMQLMFFVLFLLFYVVIMVGNLLILLMVFSDSRLHTPMYFF
LSNLSFVDIAYSSPTAPKMIEDFVSEKKTISYWGCITXFTFHFFGCAEIFVLTVMAFDR
YAAICQSLRYTVIMSANAYTVLASLSWLGALGHSFVQTLLTFQLPFCNAQVIDHYFCDVH
PVLKLACADTTLVNMLVVANSGLISLGCFLILLASYTVILFSLQKQSAESXKVLSTCGS
HLTIVTFFFVPCIFIY/PSTTFPLDKAVSVFYTTITPMLNPLIYTLRNEE/KNAMRRL
WSSKISLKEKQRG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 22,345,306 22,345,306 SNP A/C rs12438744 (DbSNP)
15 22,345,178 22,345,178 SNP A/C rs61690271 (DbSNP)
15 22,344,871 22,344,871 SNP A/G rs28571003 (DbSNP)
15 22,344,917 22,344,917 SNP A/G rs57659982 (DbSNP)
15 22,345,134 22,345,134 SNP C/G rs13380116 (DbSNP)
15 22,344,879 22,344,879 SNP C/G rs1366870 (DbSNP)
15 22,344,951 22,344,951 SNP C/T rs1366871 (DbSNP)
15 22,345,275 22,345,275 SNP C/T rs58381099 (DbSNP)
15 22,345,097 22,345,097 SNP C/T rs12440831 (DbSNP)
15 22,345,546 22,345,546 SNP C/T rs13380139 (DbSNP)
15 22,344,780 22,344,780 SNP C/T rs8038027 (DbSNP)
15 22,344,739 22,344,739 SNP C/T rs58030160 (DbSNP)
15 22,345,158 22,345,158 SNP C/T rs1529528 (DbSNP)
15 22,345,038 22,345,038 SNP C/T rs1429471 (DbSNP)
15 22,345,413 22,345,413 SNP G/T rs12917200 (DbSNP)
15 22,056,788 22,056,788 SNP T/C 1000GP (CEU, CHBJPT)
15 22,056,829 22,056,829 SNP T/C 1000GP (CEU, CHBJPT)
15 22,057,087 22,057,087 SNP T/C 1000GP (CEU)
15 22,057,355 22,057,355 SNP A/C 1000GP (CEU, CHBJPT)
15 22,057,539 22,057,539 SNP A/G 1000GP (CEU, CHBJPT)
15 22,057,595 22,057,595 SNP C/T 1000GP (CEU, CHBJPT)
15 100 -100 SNP T/C 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 22,307,069 22,474,088 CopyNumber Variation_2182 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 22,320,036 22,588,036 CopyNumber Variation_8782 (DGV), Variation_34557 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 21,200,251 22,588,036 CopyNumber Variation_8786 (DGV)
15 22,320,057 22,588,019 CopyNumber Variation_9249 (DGV), Variation_34643 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 22,320,057 22,777,875 CopyNumber Variation_9252 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 22,265,649 22,591,752 CopyNumber Variation_37535 (DGV), Variation_37626 (DGV)
15 22,302,006 22,588,022 CopyNumber Variation_38952 (DGV)
15 20,161,372 22,351,239 CopyNumber Variation_49466 (DGV)
15 20,161,372 22,368,110 CopyNumber Variation_49467 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 22,287,131 22,399,235 CopyNumber Variation_59598 (DGV)
15 22,304,940 22,427,590 CopyNumber Variation_72152 (DGV)
15 22,343,976 22,373,055 CopyNumber Variation_72153 (DGV)
15 22,262,185 22,596,129 CopyNumber Variation_72162 (DGV)
15 22,262,185 22,373,349 CopyNumber Variation_72167 (DGV)
15 22,262,145 22,453,425 CopyNumber Variation_76813 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,362,809 22,453,425 CopyNumber Variation_76815 (DGV)
15 22,286,537 22,453,425 CopyNumber Variation_87461 (DGV)
15 21,276,422 22,453,425 CopyNumber Variation_87468 (DGV)
15 22,344,560 22,347,590 Deletion, CopyNumber #261 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.