Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K1 Olfactory Receptor

Gene Symbol OR4K11 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR14-19, HsOR14.1.13, ORL3701
External Ids HGNC: 14726   GeneBank: AB065879, AB065881, AF399570, BK004356, NM_001004063   ORDB: ORL3701   
Build #39 labels OR4K1
Chromosomal location 14:19,935,667-19,936,599 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K15 63.73% 306
OR4K16P 68.2% 305
OR4K3P 62.26% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K1 91% 311
Dog OR4K1B 91% 311
Chimp CONTIG794.3-2780 97% 311
Mouse Or4k1 86% 311
Rat Or4k1-ps 85% 311
Cow OR4K1P 93% 311

Expression evidences

Source Accession
mRNA BC151145

Sequence information

Nucleotide sequence ATGGCTCACACAAATGAATCGATGGTGTCTGAGTTTGTACTTTTGGGACTCTCTAATTCC
TGGGGACTTCAACTTTTCTTTTTTGCCATCTTCTCTATAGTCTATGTGACATCAGTGCTA
GGCAATGTCTTAATTATTGTCATTATTTCTTTTGACTCCCATTTGAACTCTCCTATGTAC
TTCTTGCTCAGTAATCTTTCTTTCATTGATATCTGTCAGTCTAACTTTGCCACCCCCAAG
ATGCTTGTAGACTTTTTTATTGAGCGCAAGACTATCTCCTTTGAGGGTTGCATGGCCCAG
ATATTCGTTCTTCACAGTTTTGTTGGGAGTGAGATGATGTTGCTTGTAGCTATGGCATAT
GACAGATTTATAGCCATATGTAAGCCTCTGCACTACAGTACAATTATGAACCGGAGGCTC
TGTGTAATTTTTGTGTCTATTTCCTGGGCGGTGGGCGTTCTTCATTCTGTGAGCCACTTG
GCTTTTACAGTGGACCTGCCATTCTGTGGTCCCAATGAGGTGGATAGCTTCTTTTGTGAC
CTTCCCTTGGTGATAGAGCTGGCTTGCATGGATACATATGAAATGGAAATTATGACCCTA
ACGAACAGTGGCCTGATATCATTGAGCTGTTTCCTGGCTTTAATTATTTCCTACACCATC
ATTTTGATCGGTGTCCGATGCAGGTCCTCCAGTGGGTCATCTAAGGCTCTTTCTACATTA
ACTGCCCACATCACAGTGGTCATTCTTTTCTTCGGGCCTTGCATTTATTTCTATATATGG
CCTTTTAGCAGACTTCCTGTGGACAAATTTCTTTCTGTGTTCTACACTGTTTGTACTCCC
TTGTTGAACCCCATCATCTACTCTCTGAGGAATGAAGATGTTAAAGCAGCCATGTGGAAG
CTGAGAAACCGTCATGTGAACTCCTGGAAAAAC
Conceptual translation MAHTNESMVSEFVLLGLSNSWGLQLFFFAIFSIVYVTSVLGNVLIIVIISFDSHLNSPMY
FLLSNLSFIDICQSNFATPKMLVDFFIERKTISFEGCMAQIFVLHSFVGSEMMLLVAMAY
DRFIAICKPLHYSTIMNRRLCVIFVSISWAVGVLHSVSHLAFTVDLPFCGPNEVDSFFCD
LPLVIELACMDTYEMEIMTLTNSGLISLSCFLALIISYTIILIGVRCRSSSGSSKALSTL
TAHITVVILFFGPCIYFYIWPFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWK
LRNRHVNSWKN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,404,614 20,404,614 NS A/C R/S rs34608158 (DbSNP)
14 20,404,091 20,404,091 NS A/G H/R rs12885778 (DbSNP)
14 20,404,735 20,404,735 NS C/T R/C rs34394400 (DbSNP)
14 20,404,238 20,404,238 NS G/A R/Q rs3916626 (DbSNP)
14 20,404,736 20,404,736 NS G/A R/H rs2792146 (DbSNP)
14 20,404,690 20,404,690 SYN T/C L/L rs2792147 (DbSNP)
14 20,403,909 20,403,909 SYN T/C F/F rs2792148 (DbSNP)
14 19,936,576 19,936,576 NS C/T R/C 1000GP (CEU, CHBJPT)
14 19,935,750 19,935,750 SYN T/C F/F 1000GP (CEU, CHBJPT)
14 19,935,932 19,935,932 NS G/A R/H 1000GP (CEU, CHBJPT)
14 19,936,577 19,936,577 NS G/A R/H 1000GP (CEU, CHBJPT)
14 19,936,079 19,936,079 NS G/A R/Q 1000GP (CEU, CHBJPT)
14 19,936,455 19,936,455 NS C/A S/R 1000GP (CEU, CHBJPT)
14 19,936,181 19,936,181 NS A/. N/X 1000GP (CEU)
14 19,936,269 19,936,269 NS G/. T/X 1000GP (CEU)
14 100 -100 SYN T/C F/F 1000GP (YRI)
14 100 -100 NS A/T D/V 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,371,142 20,505,020 CopyNumber Variation_2175 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,219,649 20,415,445 CopyNumber Variation_4826 (DGV)
14 20,362,952 20,525,999 CopyNumber Variation_4827 (DGV)
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,239,479 20,422,583 CopyNumber Variation_8764 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,267,014 20,433,060 CopyNumber Variation_34563 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,239,246 20,432,988 CopyNumber Variation_34659 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 20,200,183 20,423,372 CopyNumber Variation_38951 (DGV)
14 20,305,431 20,404,091 CopyNumber Variation_49301 (DGV)
14 20,305,431 20,425,051 CopyNumber Variation_49302 (DGV), Variation_49303 (DGV)
14 20,305,431 20,432,664 CopyNumber Variation_49304 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,289,680 20,425,312 CopyNumber Variation_71860 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,326,958 20,419,574 CopyNumber Variation_76555 (DGV)
14 20,283,374 20,419,574 CopyNumber Variation_76556 (DGV)
14 20,386,907 20,419,574 CopyNumber Variation_76559 (DGV)
14 20,299,695 20,419,574 CopyNumber Variation_87113 (DGV)
CopyNumber 111 (Hasin)
14 20,403,726 20,406,758 CopyNumber #162 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S74C D84V R89C R89H R138Q N172S V184G M190I G224S L249H P253T I259T S263R R304C % Freq CORP
1 S D R R R N V M G L P I S R 47.93 0.257
2 S D R R Q N V M G L P I S R 17.51 0.257
3 S D R H R N V M G L P I R C 17.43 0.257
4 S D R H R N V M G L P I S R 5.68 0.257
5 S D R H R N V M G L P I S C 4.15 0.257
6 S D R R R N V I G L P I S R 3.00 0.257
7 S V R H R N V M G L P I S R 1.92 0.257
8 S D R R R N G M G L P I S R 0.38 0.257
9 S D R R R N V M G L P I R C 0.31 0.257
10 S D R R R N V M S L P I S R 0.23 0.257
11 S D R H Q N V M G L P I S R 0.15 0.257
12 S D R R Q N V M G L T I S R 0.15 0.257
13 S D R R R N V M G H P I S R 0.15 0.257
14 S D R R R S V M G L P I S R 0.15 0.257
15 S D R R R N V M G L P I R R 0.15 0.257
16 S D R R R N V M G L P I S C 0.15 0.257
17 S D R R R N V I G L P I R C 0.08 0.257
18 S V R R R N V M G L P I S R 0.08 0.257
19 S D R H R N V M G L P I R R 0.08 0.257
20 S D R R R N V M G L P T S R 0.08 0.257
21 S D C R R N V M G L P I S R 0.08 0.257
22 S D R R Q N V M S L P I S R 0.08 0.257
23 C D R R R N V M G L P I S R 0.08 0.257

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4K1.aApr07-unspliced main_exon CDS chr14 19,935,667 19,936,599 +
3UTR chr14 19,936,599 19,936,602 +