Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K14 Olfactory Receptor

Gene Symbol OR4K141 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR14-22, OR14-18, HsOR14.1.17, ORL3700
External Ids HGNC: 15352   GeneBank: AB065880, AF399572, BK004521, BK004816, NM_001004712   ORDB: ORL3700   
Build #39 labels OR4K14
Chromosomal location 14:20,014,264-20,015,193 (-)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K13 67.77% 301
OR4K15 67.21% 305
OR4K3P 68% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K14 86% 308
Chimp CONTIG*********** 97% 310
Mouse Or4k15 67% 305
Rat Or4k15 67% 305
Cow OR4K14 86% 310

Expression evidences

Source Accession
GNF Atlas2 gnf1h02813_at

Sequence information

Nucleotide sequence ATGGACCCACAGAACTATTCCTTGGTGTCAGAATTTGTGTTGCATGGACTCTGCACTTCA
CGACATCTTCAAAATTTTTTCTTTATATTTTTCTTTGGGGTCTATGTGGCCATTATGCTG
GGTAACCTTCTCATTTTGGTCACTGTAATTTCTGATCCCTGCCTGCACTCCTCCCCTATG
TACTTCCTGCTGGGGAACCTAGCTTTCCTGGACATGTGGCTGGCCTCATTTGCCACTCCC
AAGATGATCAGGGATTTCCTTAGTGATCAAAAACTCATCTCCTTTGGAGGATGTATGGCT
CAAATCTTCTTCTTGCACTTTACTGGTGGGGCTGAGATGGTGCTCCTGGTTTCCATGGCC
TATGACAGATATGTGGCCATATGCAAACCCTTGCATTACATGACTTTGATGAGTTGGCAG
ACTTGCATCAGGCTGGTGCTGGCTTCATGGGTCGTTGGATTTGTGCACTCCATCAGTCAA
GTGGCTTTCACTGTAAATTTGCCTTACTGTGGCCCCAATGAGGTAGACAGCTTCTTCTGT
GACCTCCCTCTGGTGATCAAACTTGCCTGCATGGACACCTATGTCTTGGGTATAATTATG
ATCTCAGACAGTGGGTTGCTTTCCTTGAGCTGTTTTCTGCTCCTCCTGATCTCCTACACC
GTGATCCTCCTCGCTATCAGACAGCGTGCTGCCGGTAGCACATCCAAAGCACTCTCCACT
TGCTCTGCACATATCATGGTAGTGACGCTGTTCTTTGGCCCTTGCATTTTTGTTTATGTG
CGGCCTTTCAGTAGGTTCTCTGTGGACAAGCTGCTGTCTGTGTTTTATACCATTTTTACT
CCACTCCTGAACCCCATTATCTACACATTGAGAAATGAGGAGATGAAAGCAGCTATGAAG
AAACTGCAAAACCGACGGGTGACTTTTCAA
Conceptual translation MDPQNYSLVSEFVLHGLCTSRHLQNFFFIFFFGVYVAIMLGNLLILVTVISDPCLHSSPM
YFLLGNLAFLDMWLASFATPKMIRDFLSDQKLISFGGCMAQIFFLHFTGGAEMVLLVSMA
YDRYVAICKPLHYMTLMSWQTCIRLVLASWVVGFVHSISQVAFTVNLPYCGPNEVDSFFC
DLPLVIKLACMDTYVLGIIMISDSGLLSLSCFLLLLISYTVILLAIRQRAAGSTSKALST
CSAHIMVVTLFFGPCIFVYVRPFSRFSVDKLLSVFYTIFTPLLNPIIYTLRNEEMKAAMK
KLQNRRVTFQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,482,919 20,482,919 NS A/C L/R rs17308108 (DbSNP)
14 20,482,998 20,482,998 NS C/T V/M rs7157076 (DbSNP)
14 20,482,471 20,482,471 SYN C/T E/E rs12590785 (DbSNP)
14 20,014,312 20,014,312 SYN C/T E/E 1000GP (CEU, CHBJPT)
14 20,014,760 20,014,760 NS A/C L/R 1000GP (CEU, CHBJPT)
14 20,014,786 20,014,786 SYN C/T L/L 1000GP (CHBJPT)
14 100 -100 SYN C/T E/E 1000GP (YRI, YRI)
14 100 -100 NS G/A P/L 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,371,142 20,505,020 CopyNumber Variation_2175 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,362,952 20,525,999 CopyNumber Variation_4827 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,465,300 20,483,617 CopyNumber Variation_76560 (DGV), Variation_87119 (DGV)
14 20,473,893 20,483,617 CopyNumber Variation_87120 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P281L V247A I217V V152A L145R M119V % Freq CORP
1 P V I V L M 83.18 0.081
2 P V I V R M 7.45 0.081
3 P V I V L V 6.84 0.261
4 L V I V L M 1.77 0.141
5 P A I V L M 0.46 0.081
6 P V I A L M 0.23 0.081
7 P V V V L M 0.08 0.081

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4K14.aApr07-unspliced main_exon 3UTR chr14 20,014,261 20,014,264 -
CDS chr14 20,014,264 20,015,193 -