Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K16P Olfactory Receptor

Gene Symbol OR4K16P1 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene Yes
CORP pseudogene probability score
Aliases OR14-24, HsOR14.1.14P, ORL3714
External Ids HGNC: 15354   GeneBank: AF399443, BK004812, NG_004172   ORDB: ORL3714   
Build #39 labels OR4K16P
Chromosomal location 14:19,956,547-19,957,554 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K1 68.2% 305
OR4K15 64.5% 307
OR4K3P 65.22% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K1 68% 308
Mouse Or4k1 66% 308
Rat Or4k1-ps 66% 308
Cow OR4K1P 70% 304
Orang OR4K1 67% 308
Horse OR4K16CP 86% 309
Horse OR4K16BP 86% 309
Chimp OR4K1 68% 308

Sequence information

Nucleotide sequence ATCTTAATTATCTTTTCTTCCCTCTAGATAACTTCAGCAGCTCAGATTCAGTTAATGGAT
GGAGTAATAAATCAGTGGTTACTGAATTCAATTTGTTGGGGCTGTCTAGCTCTTGGGAAC
TCCAAGTCTTCTTTTTCTTTATCTTCTCTGTGTTTTATGGAGCTGCAGTGTTGGGAAACA
TCCTTATCATCATCACAGTAATTATAGACTCTCATTTGCATTCCCCAATGTACTTTCTTC
TTAGCAATCTCTCTTCCATCGATGTGTGTCAGGCTACATTTGCCACTCCCAAGATGATTG
CAGACTTCCTCAACGAACACAAGACCACCACTTTCCAGGGATGCATGTCACAAATCTTTT
TCTTGCATGTTTTTGGGGGTAGTGAGATGGTGCTTCTTGTTGCCATGGCCTATGATAGAT
ACATTGCTATATGCAAACCTCTGCACTACATGACCATCATGAACCGGAGGGTGTGAACTG
TTCTGGTGGGGGTTTCCTGGGCCATTGGCATCTCACACTCAGCCACCCACCTGGCATTCA
AAGTCAATCTGCCTTTCTGTGGACCCAACAGGGTAGACAATTTTTTCTGTGACCTCCTCC
TAGTGATCAAGCTTGCCTGCTTAGACACCTATGGTTTTGAGATACTGGTGCTCACTAACA
GTGGTCTGCTCTCACTTATGTGTTTCCTCCTTTTGCTCATTTCTGACACTATCATCCTTG
CTACTGTGCATCGCCAAGCCTCTGATGGGATGTCCAAGGCCCTTTCCACTCTGTCTGCCC
ACATTACTGTTGTGCTTCTCTTCTTTGGCCCATTAATATTCATCTATATTTGGCCCTTTG
AAAGCTTCCCAATTGATAAATTTATCTCTGTGTTTTTTTACTGTCTTCACTCCTCTCCTT
AACCCCATGATTTATACTCTGAGGAATAAAGATATAAAGGAAGCCATGAGGAAGCTAAGG
AGATGACATGTGGGTTCCAAGCAGGGTTTTTAGACAACTACAAAGAAG
Conceptual translation ILIIFSSLXTSAAQIQLXGWSNKSVVTEFNLLGLSSSWELQVFFFFIFSVFYGAAVLG
NILIIITVIIDSHLHSPMYFLLSNLSSIDVCQATFATPKMIADFLNEHKTTTFQGCMSQI
FFLHVFGGSEMVLLVAMAYDRYIAICKPLHYMTIMNRRVXVLVGVSWAIGISHSATHLA
FKVNLPFCGPNRVDNFFCDLLLVIKLACLDTYGFEILVLTNSGLLSLMCFLLLLISDTII
LATVHRQASDGMSKALSTLSAHITVVLLFFGPLIFIYIWPFESFPIDKFISVFF\VFTP
LLNPMIYTLRNKDIKEAMRKLRRXVGSKQGFXTTKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
14 19,956,767 19,956,767 SNP T/A 1000GP (CEU, CHBJPT)
14 19,956,803 19,956,803 SNP C/T 1000GP (CEU)
14 19,956,892 19,956,892 SNP T/C 1000GP (CEU, CHBJPT)
14 19,957,012 19,957,012 SNP G/A 1000GP (CEU, CHBJPT)
14 19,957,021 19,957,021 SNP G/A 1000GP (CEU, CHBJPT)
14 19,957,061 19,957,061 SNP A/G 1000GP (CEU, CHBJPT)
14 19,957,116 19,957,116 SNP A/C 1000GP (CHBJPT)
14 19,957,526 19,957,526 SNP A/G 1000GP (CEU)
14 20,424,926 20,424,926 SNP A/T rs4456427 (DbSNP)
14 20,425,051 20,425,051 SNP C/T rs10484218 (DbSNP)
14 20,425,171 20,425,171 SNP A/G rs10144573 (DbSNP)
14 20,425,180 20,425,180 SNP A/G rs4603473 (DbSNP)
14 20,425,220 20,425,220 SNP A/G rs10135235 (DbSNP)
14 20,425,374 20,425,375 Del(2) -/CT rs67012843 (DbSNP)
14 20,425,376 20,425,377 In-Del(2) -/GA rs72519877 (DbSNP)
14 20,425,377 20,425,378 Del(2) -/TC rs33912694 (DbSNP)
14 20,425,696 20,425,696 Del(1) -/T rs34325501 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,239,246 20,432,988 CopyNumber Variation_34659 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,267,014 20,433,060 CopyNumber Variation_34563 (DGV)
14 20,289,680 20,425,312 CopyNumber Variation_71860 (DGV)
14 20,305,431 20,425,051 CopyNumber Variation_49302 (DGV), Variation_49303 (DGV)
14 20,305,431 20,432,664 CopyNumber Variation_49304 (DGV)
14 20,362,952 20,525,999 CopyNumber Variation_4827 (DGV)
14 20,371,142 20,505,020 CopyNumber Variation_2175 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.