Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K5 Olfactory Receptor

Gene Symbol OR4K51 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR14-16, HsOR14.1.12, ORL3684
External Ids HGNC: 14745   GeneBank: AB065882, BK004355, NM_001005483   ORDB: ORL3684   
Build #39 labels OR4K5
Chromosomal location 14:19,920,607-19,921,575 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K11P 65.52% 319
OR4K15 68.65% 319
OR4K8P 64.89% 319

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K5 87% 323
Dog OR4K5B 86% 323
Chimp CONTIG1808.4-651 96% 323
Mouse Or4k5 82% 323
Rat Or4k5 82% 319
Cow OR4K5 88% 323

Expression evidences

Source Accession
mRNA BC140947

Sequence information

Nucleotide sequence ATGGATAAGTCCAATTCTTCAGTGGTGTCTGAATTTGTACTGTTGGGACTCTGTAGTTCT
CAAAAACTCCAGCTTTTCTATTTTTGTTTCTTCTCTGTGTTGTATACAGTCATTGTGCTG
GGAAATCTTCTCATTATCCTCACAGTGACTTCTGATACCAGCCTGCACTCCCCTATGTAC
TTTCTCTTGGGAAACCTTTCCTTTGTTGACATTTGTCAGGCTTCTTTTGCTACCCCTAAA
ATGATTGCAGATTTTCTGAGTGCACACGAGACCATATCTTTCAGTGGCTGCATAGCCCAA
ATTTTCTTTATTCACCTTTTTACTGGAGGGGAGATGGTGCTACTTGTTTCGATGGCCTAT
GACAGGTATGTAGCCATATGCAAACCCTTATACTATGTGGTCATCATGAGCCGAAGGACA
TGCACTGTCTTGGTAATGATCTCCTGGGCTGTGAGCTTGGTGCACACATTAAGCCAGTTA
TCATTTACTGTGAACCTGCCTTTTTGTGGACCTAATGTAGTAGACAGCTTTTTTTGTGAT
CTTCCTCGAGTCACCAAACTTGCCTGCCTGGACTCTTACATCATTGAAATACTAATTGTG
GTCAATAGTGGAATTCTTTCCCTAAGCACTTTCTCTCTCTTGGTCAGCTCCTACATCATT
ATTCTTGTTACAGTTTGGCTCAAGTCTTCAGCTGCAATGGCAAAGGCATTTTCTACGCTG
GCTTCCCATATTGCAGTAGTAATATTATTCTTTGGACCTTGCATCTTCATCTATGTGTGG
CCCTTTACCATCTCTCCTTTGGATAAATTTCTTGCCATATTTTACACTGTTTTCACCCCC
GTCCTAAACCCCATTATTTATACACTAAGGAATAGGGATATGAAGGCTGCCGTAAGGAAA
ATTGTGAACCATTACCTGAGGCCAAGGAGAATTTCTGAAATGTCACTAGTAGTGAGAACT
TCCTTTCAT
Conceptual translation MDKSNSSVVSEFVLLGLCSSQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMY
FLLGNLSFVDICQASFATPKMIADFLSAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAY
DRYVAICKPLYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCD
LPRVTKLACLDSYIIEILIVVNSGILSLSTFSLLVSSYIIILVTVWLKSSAAMAKAFSTL
ASHIAVVILFFGPCIFIYVWPFTISPLDKFLAIFYTVFTPVLNPIIYTLRNRDMKAAVRK
IVNHYLRPRRISEMSLVVRTSFH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,389,721 20,389,721 NS A/G K/R rs17242341 (DbSNP)
14 19,921,562 19,921,562 NS G/A R/K 1000GP (CEU, CHBJPT)
14 19,920,906 19,920,906 SYN A/G Q/Q 1000GP (CHBJPT)
14 19,921,447 19,921,447 NS G/A V/I 1000GP (CHBJPT)
14 100 -100 NS C/A N/K 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,197,616 20,399,048 CopyNumber Variation_0316 (DGV)
14 20,371,142 20,505,020 CopyNumber Variation_2175 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,219,649 20,415,445 CopyNumber Variation_4826 (DGV)
14 20,362,952 20,525,999 CopyNumber Variation_4827 (DGV)
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,239,479 20,422,583 CopyNumber Variation_8764 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,267,014 20,433,060 CopyNumber Variation_34563 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,239,246 20,432,988 CopyNumber Variation_34659 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 20,200,183 20,423,372 CopyNumber Variation_38951 (DGV)
14 20,305,431 20,404,091 CopyNumber Variation_49301 (DGV)
14 20,305,431 20,425,051 CopyNumber Variation_49302 (DGV), Variation_49303 (DGV)
14 20,305,431 20,432,664 CopyNumber Variation_49304 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,289,680 20,425,312 CopyNumber Variation_71860 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,326,958 20,419,574 CopyNumber Variation_76555 (DGV)
14 20,283,374 20,419,574 CopyNumber Variation_76556 (DGV)
14 20,386,907 20,419,574 CopyNumber Variation_76559 (DGV)
14 20,299,695 20,419,574 CopyNumber Variation_87113 (DGV)
14 20,348,406 20,398,665 CopyNumber Variation_101887 (DGV)
14 20,388,666 20,391,734 CopyNumber #164 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N65K D70Y A77V I92V H105P S117L V259A W260R V281I T288I R319K % Freq CORP
1 N D A I H S V W V T R 75.35 0.257
2 N D A I H S V W I T K 15.36 0.257
3 N D A V H S V W V T R 3.07 0.365
4 N D A I H L V W V T R 1.38 0.257
5 K D A I H S V R V T R 1.23 0.257
6 N D A I H S A W V T R 1.08 0.257
7 N D A I H S V W I T R 0.61 0.257
8 N Y A I H S V W V T R 0.38 0.752
9 N D A I P S V W V T R 0.23 0.257
10 N D V I H S A W V T R 0.23 0.257
11 N D A I H S V W V I R 0.23 0.257
12 N D A V H S V W I T R 0.15 0.365
13 K D A I H S V W V T R 0.15 0.257
14 N D A V H L V W V T R 0.08 0.365
15 N D A I H S V W V T K 0.08 0.257
16 N D A I H S A W I T K 0.08 0.257
17 N D A I H S V W I I K 0.08 0.257
18 N D A I H S V W I I R 0.08 0.257
19 N Y A I H S V W I T K 0.08 0.752
20 N D A I P S A W V T R 0.08 0.257

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4K5.aApr07-unspliced main_exon CDS chr14 19,920,607 19,921,575 +
3UTR chr14 19,921,575 19,921,578 +