Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K7P Olfactory Receptor

Gene Symbol OR4K7P1 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene Yes
CORP pseudogene probability score
Aliases OR18-2, HsOR18.1.1P, ORL3751
External Ids HGNC: 14756   GeneBank: BK004744   ORDB: ORL3751   
Build #39 labels OR4K10P, OR4K7P
Chromosomal location 18:14,570,844-14,571,776 (+)
Cluster 18@15
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K12P 97.75% 311
OR4K6P 94.23% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K6 86% 312
Mouse Or4k6 84% 312
Rat Or4k6 84% 312
Cow OR4K6 86% 312
Orang OR4K6P 91% 310
Horse OR4K6 87% 312
Chimp OR4K7BP 98% 309
Chimp OR4K7DP 97% 311
Chimp OR4K7CP 97% 310

Expression evidences

Source Accession
ESTs EG328634

Sequence information

Nucleotide sequence ATGGAGGGGTTCAACTATTCCAGAGTATCTGAATTCATGTTACTTGGACTTACTGATTCT
CCTGAACTCCAGATATTCTTTTTTGTGGTGTTTTCTGTCTTCTATTTAATGACCATGTTA
GGCAGCTGCCTGATTTTGCTCACTGTCCTATCCACCTCACACCTTCACTCTCGCATGTAC
TTCCTGCTCAGCAACCTGTCTCATTGACATGTGCCTGTCCTCCTTTGCCACACCAAAGAT
GATTATGGACTTTTTTGCTCTGCGTAAGACCATCTCTTTTGAAGGCTGCATTTCTCAGAT
CTTTTTTTTACACCTCTTCAATGGGACTGAGATTGTGCTGCTGATCTCCATGTCTTTTGA
CAGGTATATTGCCATATGTAAACCTCTCCACTATTCAACAATTATGAGCCAAAGAGTGTG
TGTTGAGCTTGTGGCAGTTTCTTGTTGGACAGTGGGCTTTCTACATACAATGAGCCAATT
AGTTTTTCCCTCTATTTGCCCTTCTGTGTTCCCAATGTTGTAGACAGTTTTTTCTGTGAT
CTTCCTTTGGTCATCCAGTTAGCTTGTATAGATATTTATGTTCTTGGGACCTCCATGATT
TCAACCAGTGGTGTGATTGCTCTTATAAGTTTTCTGCTTTTGCTCACCTCCTACATCATT
GTTCTTAATATTGTCAGGGACTACTCCTCCACAGGATCCTCCAAGGCTCTTTCTACCTGT
ACAGCGCATTTTATTGTTGTGTTAATGTTCTTTGGGCCCTGTATTTTCATTTATGTGTGG
CCTTCCACAAACTTCCTGGTAGACAAAATTCTCTCCGTTTTCTATACCATCTTCACTCCC
TTTCTGAATCCACTTATCTATACTTTGAGAAACCAGGAAGTGAAGACAGCAATGAAGAAG
AAACTGAATATTCAGTATTTCAGTCTTGGGAAA
Conceptual translation MEGFNYSRVSEFMLLGLTDSPELQIFFFVVFSVFYLMTMLGSCLILLTVLSTSHLHSRMY
FLLSNLS\DMCLSSFATPKMIMDFFALRKTISFEGCISQIFFLHLFNGTEIVLLISMSF
DRYIAICKPLHYSTIMSQRVCVELVAVSCWTVGFLHTMSQLVFP/YLPFCVPNVVDSFF
CDLPLVIQLACIDIYVLGTSMISTSGVIALISFLLLLTSYIIVLNIVRDYSSTGSSKALS
TCTAHFIVVLMFFGPCIFIYVWPSTNFLVDKILSVFYTIFTPFLNPLIYTLRNQEVKTAM
KKKLNIQYFSLGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
18 14,571,038 14,571,038 SNP A/C rs2646607 (DbSNP)
18 14,570,962 14,570,962 SNP A/G rs7242086 (DbSNP)
18 14,571,568 14,571,568 SNP A/G rs2646611 (DbSNP)
18 14,571,513 14,571,513 SNP C/T rs2646610 (DbSNP)
18 14,570,925 14,570,925 SNP C/T rs28582232 (DbSNP)
18 14,571,018 14,571,018 SNP C/T rs2646606 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
18 13,998,748 15,377,893 CopyNumber Variation_4053 (DGV)
18 14,432,183 14,609,021 CopyNumber Variation_5046 (DGV)
18 14,557,186 14,599,685 CopyNumber Variation_30865 (DGV)
18 14,442,131 14,582,112 CopyNumber Variation_32203 (DGV)
18 14,431,322 14,599,321 CopyNumber Variation_73119 (DGV)
CopyNumber 233 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.