Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4K8P Olfactory Receptor

Gene Symbol OR4K8P1 (View this gene in GeneCards)
Family 4
Subfamily K
Pseudogene Yes
CORP pseudogene probability score
Aliases OR18-1, HsOR18.1.2P, ORL3207
External Ids HGNC: 14787   GeneBank: BK004699, NG_002222   ORDB: ORL3207   
Build #39 labels OR4K8P, OR4K9P
Chromosomal location 18:14,613,210-14,614,163 (+)
Cluster 18@15
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K11P 97.8% 318
OR4K15 93.71% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4K15 91% 318
Mouse Or4k15 90% 318
Rat Or4k15 90% 318
Cow OR4K15 89% 311
Orang OR4K15 95% 318
Orang OR4K15H 94% 318
Horse OR4K15 88% 318
Chimp OR4K11P 97% 316
Chimp OR4K11BP 95% 301

Expression evidences

Source Accession
ESTs GD260809

Sequence information

Nucleotide sequence ATGAATGAGACAAATCATTCTTGGGTGACAGAATTTGTGTTGCTGGGACTGTCTAGTTCA
AGGGAGCTCCAACCTTTCTTGTTTCTTATATTTTCACTACTTTATCTAGCAATTCTGTTG
GGCAACTTTCTCATCATCCTCACTGTGACCTCAGATTCCCGCCTTCACACCCCCATGTAC
TTTCTGCTTGCAAACCTGTCATTTATAGACGTATGTGTTGCCTCTTCTGCTACCCCTAAA
ATGATTGCAGACTTTCTGGTTGAGCACAAGACTATTTCTTTTGATGCCCACCTGGCCCAG
ATTTTCTTTGTTCATCTCTTCACTGGCAGTGAAATGGTGCTCCTAGTTTCCATGGCCTAT
GACCGTTATGTTGCTATATGCAAACCTCCCCACTACATGACAATCATGAGCTGCTGTGTA
TGTGTTGTGCTCGTCCTCATTTCCTGGTTTGTGGGCTTCATCCATACCACCAGCCAGTTG
GCATTCACGTTAATCTGCCATTTTGTGGTCCTAATAAGGTAGATAGTTTTTTTCTGTGAC
CTTCCTCTAGCGACGAAGTTAGCCTGCATAGACACTTATGTTGTCAGCCTACTAATAGTT
GCAGATAGTGGCTTTCTTTCTCTGAGTTCCTTTCTCCTCTTGGTTGTCTCCTACACTGTA
ATACTTGTTACAGTTAGGAATCGCTCCTCTGTAAGCATGGTGAAGGCCCACTCCACATTG
ACTGCTCACATCACTGTGGTCACTTTATTCTTTGGATCGTGTATTTTCATCTATGTGTGG
CCCTTCAGCAGTTACTCAGTTGACAAAGTCCTTGCTGTATTCTACACCATCTTCACGTCT
ATTTTAAACCCTGTAATCTACATGCTAAGAAACAAAGAAGTGAAGGCAGCTATGTCAAAA
CTGAAGAGTCGGTATCAGAAGCTTGGTCAGGTTTCTGTAGTCATAAGAAACGTT
Conceptual translation MNETNHSWVTEFVLLGLSSSRELQPFLFLIFSLLYLAILLGNFLIILTVTSDSRLHTPMY
FLLANLSFIDVCVASSATPKMIADFLVEHKTISFDAHLAQIFFVHLFTGSEMVLLVSMAY
DRYVAICKPPHYMTIMSCCVCVVLVLISWFVGFIHTTSQLAFT/NLPFCGPNKVDSFF\br/>CDLPLATKLACIDTYVVSLLIVADSGFLSLSSFLLLVVSYTVILVTVRNRSSVSMVKAHS
TLTAHITVVTLFFGSCIFIYVWPFSSYSVDKVLAVFYTIFTSILNPVIYMLRNKEVKAAM
SKLKSRYQKLGQVSVVIRNV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
18 14,613,890 14,613,890 SNP A/C rs2646597 (DbSNP)
18 14,613,918 14,613,918 SNP A/G rs2646599 (DbSNP)
18 14,613,726 14,613,726 SNP A/G rs8093060 (DbSNP)
18 14,613,815 14,613,815 SNP A/G rs12960773 (DbSNP)
18 14,613,763 14,613,763 SNP C/G rs2646596 (DbSNP)
18 14,613,917 14,613,917 SNP C/T rs2646598 (DbSNP)
18 14,613,759 14,613,759 SNP C/T rs2646595 (DbSNP)
18 14,613,965 14,613,965 SNP C/T rs2646600 (DbSNP)
18 14,613,507 14,613,507 SNP C/A 1000GP (CEU)
18 100 -100 SNP C/A 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
18 13,998,748 15,377,893 CopyNumber Variation_4053 (DGV)
18 14,612,921 14,616,051 CopyNumber Variation_67309 (DGV)
CopyNumber 182 (Hasin)
18 14,613,109 14,616,162 Deletion #244 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.