Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4L1 Olfactory Receptor

Gene Symbol OR4L11 (View this gene in GeneCards)
Family 4
Subfamily L
Pseudogene No
CORP pseudogene probability score
Aliases OR14-28, HsOR14.1.20, ORL3688
External Ids HGNC: 15356   GeneBank: AB065558, BK004467, NM_001004717   ORDB: ORL3688   
Build #39 labels OR4L1, OR4L2P
Chromosomal location 14:20,060,045-20,060,980 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks Segregating Pseudo Gene, a polymorphism of 19 bp del at positions 248-267

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4K15 58.06% 310
OR4K16P 59.09% 308
OR4K3P 61.46% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4L1 80% 312
Chimp CONTIG794.21-17751 96% 214
Mouse Or4l1 80% 307
Rat Or4l1 80% 307
Cow OR4L1 81% 308

Sequence information

Nucleotide sequence ATGGATCTTAAAAATGGATCTCTAGTGACCGAGTTTATTTTACTAGGATTTTTTGGACGA
TGGGAACTTCAAATTTTCTTCTTTGTGACATTTTCCCTGATCTACGGTGCTACTGTGATG
GGAAACATTCTCATTATGGTCACAGTGACATGTAGGTCAACCCTTCATTCTCCCTTGTAC
TTTCTCCTTGGAAATCTCTCTTTTTTGGACATGTGTCTCTCCACTGCCACAACACCCAAG
ATGATCATAGATTTGCTCACTGACCACAAGACCATCTCTGTGTGGGGCTGCGTGACCCAG
ATGTTCTTCATGCACTTCTTTGGGGGTGCTGAGATGACTCTTCTGATAATCATGGCCTTT
GACAGGTATGTAGCCATATGTAAACCCCTGCACTATAGGACAATCATGAGCCACAAGCTG
CTAAAGGGGTTTGCGATACTTTCATGGATAATTGGTTTTTTACACTCCATAAGCCAGATA
GTTTTAACAATGAACTTGCCTTTCTGTGGCCACAATGTCATAAACAACATATTTTGTGAT
CTTCCCCTTGTGATCAAGCTTGCTTGCATTGAAACATACACCCTGGAATTATTTGTCATT
GCTGACAGCGGGCTGCTCTCTTTCACCTGTTTCATCCTCTTGCTTGTTTCTTACATTGTC
ATCCTGGTCAGTGTACCAAAAAAATCATCACATGGGCTCTCCAAGGCGCTGTCCACATTG
TCTGCCCACATCATTGTGGTCACTCTGTTCTTTGGACCTTGTATTTTTATCTATGTTTGG
CCATTCAGTAGTTTGGCAAGCAATAAAACTCTTGCCGTATTTTATACAGTTATCACACCC
TTACTGAATCCGAGTATTTATACCCTGAGAAATAAGAAAATGCAAGAGGCCATAAGAAAA
TTACGGTTCCAATATGTTAGTTCTGCACAGAATTTC
Conceptual translation MDLKNGSLVTEFILLGFFGRWELQIFFFVTFSLIYGATVMGNILIMVTVTCRSTLHSPLY
FLLGNLSFLDMCLSTATTPKMIIDLLTDHKTISVWGCVTQMFFMHFFGGAEMTLLIIMAF
DRYVAICKPLHYRTIMSHKLLKGFAILSWIIGFLHSISQIVLTMNLPFCGHNVINNIFCD
LPLVIKLACIETYTLELFVIADSGLLSFTCFILLLVSYIVILVSVPKKSSHGLSKALSTL
SAHIIVVTLFFGPCIFIYVWPFSSLASNKTLAVFYTVITPLLNPSIYTLRNKKMQEAIRK
LRFQYVSSAQNF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,528,451 20,528,469 Del(19) -/TAGATTTGCTCACTGACCA rs33965693 (DbSNP)
14 20,528,398 20,528,399 Del(2) -/TC rs33977614 (DbSNP)
14 20,528,751 20,528,750 Ins(1) -/C rs35605617 (DbSNP)
14 20,528,321 20,528,321 NS A/G M/V rs1958716 (DbSNP)
14 20,528,207 20,528,207 NS A/G N/D rs1958715 (DbSNP)
14 20,528,528 20,528,528 NS A/G S/G rs2775254 (DbSNP)
14 20,528,790 20,528,790 NS A/T E/V rs45439600 (DbSNP)
14 20,528,505 20,528,505 NS A/T K/M rs2775253 (DbSNP)
14 20,528,481 20,528,481 NS C/T S/F rs10139756 (DbSNP)
14 20,528,682 20,528,682 NS C/T T/I rs45585336 (DbSNP)
14 20,528,250 20,528,250 NS G/T G/V rs45584133 (DbSNP)
14 20,528,359 20,528,359 NS T/G S/R rs1959630 (DbSNP)
14 20,528,527 20,528,527 SYN A/G G/G rs10130629 (DbSNP)
14 20,528,362 20,528,362 SYN A/G S/S rs1958717 (DbSNP)
14 20,529,043 20,529,043 SYN C/G P/P rs1959628 (DbSNP)
14 20,528,308 20,528,308 SYN C/T Y/Y rs10139558 (DbSNP)
14 20,529,019 20,529,019 SYN T/C A/A rs1959629 (DbSNP)
14 20,060,860 20,060,860 SYN C/T A/A 1000GP (CEU, CHBJPT)
14 20,060,346 20,060,346 NS T/A M/K 1000GP (CEU, CHBJPT)
14 20,060,048 20,060,048 NS G/A D/N 1000GP (CEU, CHBJPT)
14 20,060,884 20,060,884 SYN C/G P/P 1000GP (CEU, CHBJPT)
14 20,060,369 20,060,369 NS G/A G/S 1000GP (CEU, CHBJPT)
14 20,060,200 20,060,200 NS G/T R/S 1000GP (CEU)
14 20,060,203 20,060,203 SYN A/G S/S 1000GP (CEU, CHBJPT)
14 20,060,523 20,060,523 NS T/C I/T 1000GP (CEU, CHBJPT)
14 20,060,091 20,060,091 NS G/T G/V 1000GP (CEU, CHBJPT)
14 20,060,162 20,060,162 NS A/G M/V 1000GP (CEU, CHBJPT)
14 100 -100 NS G/A D/N 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
14 100 -100 SYN A/G S/S 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,521,060 20,539,305 CopyNumber Variation_9724 (DGV), Variation_49305 (DGV)
14 20,528,207 20,539,305 CopyNumber Variation_9725 (DGV)
14 20,520,445 20,540,967 CopyNumber Variation_30649 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,521,435 20,539,362 CopyNumber Variation_37686 (DGV)
14 20,521,060 20,562,080 CopyNumber Variation_49306 (DGV)
14 20,524,593 20,528,461 CopyNumber Variation_66585 (DGV)
14 20,520,220 20,540,382 CopyNumber Variation_76566 (DGV)
14 20,528,104 20,531,139 CopyNumber #140 (Waszak)
14 20,528,417 20,528,651 Del(-19) #21(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D2N G16V G36S M40V R52S S93P S93F M101K G109S A119T S156T I160T E196A E296K % Freq CORP
1 D G G M S S S M G A S I E E 47.16 0.742
2 N G G V S S S K S A S I E E 38.71 0.742
3 N V G V S S S M G A S T E E 4.99 0.742
4 D G G M R S S M G A S I E E 3.07 0.742
5 N G G V S S S M G A S I E E 1.92 0.742
6 N G G V S S S M G A S T E E 0.92 0.742
7 N G G V S P S K S A S I E E 0.69 0.742
8 D G G M S S S M G T S I E E 0.46 0.814
9 N G G M S S S M G A S I E E 0.31 0.742
10 N G G V S S S K S A S I A E 0.31 0.742
11 N G S V S S S K S A S I E E 0.23 0.742
12 D G G M S S S M G A T I E E 0.15 0.742
13 N G G V S S S K S A S I E K 0.15 0.742
14 D G G V S S S M G A S T E E 0.15 0.742
15 D G G M S S F M G A T I E E 0.15 0.742
16 N V G V S S S M G A S I E E 0.15 0.742
17 D G G M S P S M G A S I E E 0.08 0.742
18 D G S M S S S M G A S I E E 0.08 0.742
19 N G G V S S S K G A S I E E 0.08 0.742
20 D G G V S S S K S A S I E E 0.08 0.742
21 N V G V S S S K S A S I E E 0.08 0.742
22 N G G M S S S M G A T I E E 0.08 0.742

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4L1.aApr07-unspliced main_exon CDS chr14 20,060,045 20,060,980 +
3UTR chr14 20,060,980 20,060,983 +