Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4M1 Olfactory Receptor

Gene Symbol OR4M11 (View this gene in GeneCards)
Family 4
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.14 (functional)
Aliases OR14-7, HsOR14.1.5, ORL4966
External Ids HGNC: 14735   GeneBank: AB065886, BK004359, NM_001005500   ORDB: ORL4966   
Build #39 labels OR4M1
Chromosomal location 14:19,780,323-19,781,261 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4M2 93.93% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4M1 94% 312
Chimp CONTIG794.32-13137 62% 310
Chimp CONTIG1808.7-22772 59% 308
Chimp CONTIG*********** 59% 296
Mouse Or4m1 91% 313
Rat Or4m1 92% 313
Cow OR4M1 93% 313

Expression evidences

Source Accession
mRNA BC136987

Sequence information

Nucleotide sequence ATGGAAACTGCAAATTACACCAAGGTGACAGAATTTGTTCTCACTGGCCTATCCCAGACT
CGGGAGGTCCAACTAGTCCTATTTGTTATATTTCTATCCTTCTATTTGTTCATCCTACCA
GGAAATATCCTTATCATTTGCACCATCAGGCTAGACCCTCATCTGACTTCTCCTATGTAT
TTCCTGTTGGCTAATCTGGCCCTCCTTGATATTTGGTACTCTTCCATTACAGCCCCTAAA
ATGCTCATAGACTTCTTTGTGGAGAGGAAGATAATTTCCTTTGGTGGATGCATTGCACAG
CTCTTCTTCTTACACTTTGTTGGGGCTTCGGAGATGTTCTTGCTCACAGTGATGGCCTAT
GACCGCTATGCTGCTATCTGCCGACCCCTCCACTATGCTACCATCATGAATCGACGTCTC
TGCTGTATCCTGGTGGCTCTCTCCTGGATGGGGGGCTTCATTCATTCTATAATACAGGTG
GCTCTCATTGTTCGACTTCCTTTCTGTGGGCCCAATGAGTTAGACAGTTACTTCTGTGAC
ATCACACAGGTTGTCCGGATTGCCTGTGCCAACACCTTCCCAGAGGAGTTAGTGATGATC
TGTAGTAGTGGTCTGATCTCTGTGGTGTGTTTCATTGCTCTGTTAATGTCCTATGCCTTC
CTTCTGGCCTTGCTCAAGAAACATTCAGGCTCAGGTGAGAATACCAACAGGGCCATGTCC
ACCTGCTATTCCCACATTACCATTGTGGTGCTAATGTTTGGGCCATCCATCTACATTTAT
GCTCGCCCATTTGACTCATTTTCCCTAGATAAAGTGGTGTCTGTGTTTCATACTGTAATA
TTCCCTTTACTTAATCCCATTATTTACACATTGAGAAACAAGGAAGTAAAGGCAGCCATG
AGGAAGGTGGTCACCAAATATATTTTGTGTGAAGAGAAG
Conceptual translation METANYTKVTEFVLTGLSQTREVQLVLFVIFLSFYLFILPGNILIICTIRLDPHLTSPMY
FLLANLALLDIWYSSITAPKMLIDFFVERKIISFGGCIAQLFFLHFVGASEMFLLTVMAY
DRYAAICRPLHYATIMNRRLCCILVALSWMGGFIHSIIQVALIVRLPFCGPNELDSYFCD
ITQVVRIACANTFPEELVMICSSGLISVVCFIALLMSYAFLLALLKKHSGSGENTNRAMS
TCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKAAM
RKVVTKYILCEEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,248,768 20,248,768 NS A/G E/G rs62619918 (DbSNP)
14 20,249,310 20,249,310 NS C/A H/N rs3968186 (DbSNP)
14 20,248,828 20,248,828 NS C/T T/I rs2635535 (DbSNP)
14 20,249,176 20,249,176 NS G/A G/D rs2815960 (DbSNP)
14 20,249,412 20,249,412 NS G/A E/K rs2318549 (DbSNP)
14 20,249,316 20,249,316 NS T/G L/V rs3968196 (DbSNP)
14 20,249,309 20,249,309 SYN T/C F/F rs3968187 (DbSNP)
14 19,780,524 19,780,524 NS C/T L/F 1000GP (CEU)
14 19,780,669 19,780,669 NS C/T T/I 1000GP (CEU, CHBJPT)
14 100 -100 NS G/A A/T 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,197,616 20,399,048 CopyNumber Variation_0316 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,080,166 20,271,356 CopyNumber Variation_4824 (DGV)
14 20,219,649 20,415,445 CopyNumber Variation_4826 (DGV)
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,239,479 20,422,583 CopyNumber Variation_8764 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,239,246 20,432,988 CopyNumber Variation_34659 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 19,670,757 20,331,117 CopyNumber Variation_37621 (DGV)
14 20,200,183 20,423,372 CopyNumber Variation_38951 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 20,194,500 20,255,301 CopyNumber Variation_71832 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,198,061 20,307,453 CopyNumber Variation_71859 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,185,336 20,310,638 CopyNumber Variation_76557 (DGV)
14 20,179,862 20,261,582 CopyNumber Variation_87116 (DGV)
14 20,201,654 20,343,302 CopyNumber Variation_87118 (DGV)
CopyNumber 195 (Hasin)
14 20,248,382 20,251,420 CopyNumber #166 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L44F A64T T116I I157T V208M G232D R262H % Freq CORP
1 L A T I V G R 72.27 0.259
2 L A I I V D R 24.73 0.259
3 L A T T V G R 0.69 0.259
4 L T T I M G R 0.69 0.259
5 L A T I V D R 0.61 0.259
6 L A T I V G H 0.54 0.259
7 L A I I V G R 0.23 0.259
8 F A T I V G R 0.15 0.259
9 L T T I V G R 0.08 0.259

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4M1.aApr07-unspliced main_exon CDS chr14 19,780,323 19,781,261 +
3UTR chr14 19,781,261 19,781,264 +