Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4M2 Olfactory Receptor

Gene Symbol OR4M21 (View this gene in GeneCards)
Family 4
Subfamily M
Pseudogene No
CORP pseudogene probability score
Aliases OR15-3, HsOR15.1.8, ORL3723
External Ids HGNC: 15373   GeneBank: AB065903, BK004480, NM_001004719   ORDB: ORL3723   
Build #39 labels OR4M2
Chromosomal location 15:22,080,625-22,081,563 (+)
Cluster 15@22
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4M1 93.93% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4M1 90% 312
Mouse Or4m1 88% 313
Rat Or4m1 89% 313
Cow OR4M1 90% 313
Orang OR4M1 94% 313
Orang OR4M1B 94% 313
Orang OR4M1C 93% 313
Horse OR4M1 90% 313
Chimp OR4N5 61% 310

Expression evidences

Source Accession
ESTs CR746505
mRNA BC136985
GNF Atlas2 gnf1h02900_s_at

Sequence information

Nucleotide sequence ATGGAAACTGCAAATTACACCAAGGTGACAGAATTTGTTCTCACTGGCCTATCCCAGACT
CCAGAGGTCCAACTAGTCCTATTTGTTATATTTCTATCCTTCTATTTGTTCATCCTACCA
GGAAATATCCTTATCATTTGCACCATCAGTCTAGACCCTCATCTGACCTCTCCTATGTAT
TTCCTGTTGGCTAATCTGGCCTTCCTTGATATTTGGTACTCTTCCATTACAGCCCCTGAA
ATGCTCATAGACTTCTTTGTGGAGAGGAAGATAATTTCTTTTGATGGATGCATTGCACAG
CTCTTCTTCTTACACTTTGCTGGGGCTTCGGAGATGTTCTTGCTCACAGTGATGGCCTTT
GACCTCTACACTGCTATCTGCCGACCCCTCCACTATGCTACCATCATGAATCAACGTCTC
TGCTGTATCCTGGTGGCTCTCTCCTGGAGGGGGGGCTTCATTCATTCTATCATACAGGTG
GCTCTCATTGTTCGACTTCCTTTCTGTGGGCCCAATGAGTTAGACAGTTACTTCTGTGAC
ATCACACAGGTTGTCCGGATTGCCTGTGCCAACACCTTCCCAGAGGAGTTAGTGATGATC
TGTAGTAGTGGTCTGATCTCTGTGGTGTGTTTGATTGCTCTGTTAATGTCCTATGCCTTC
CTTCTGGCCTTGTTCAAGAAACTTTCAGGCTCAGGTGAGAATACCAACAGGGCCATGTCC
ACCTGCTATTCCCACATTACCATTGTGGTGCTAATGTTTGGGCCATCCATCTACATTTAT
GCTCGCCCATTTGACTCGTTTTCCCTAGATAAAGTGGTGTCTGTGTTCAATACTTTAATA
TTCCCTTTACGTAATCCCATTATTTACACATTGAGAAACAAGGAAGTAAAGGCAGCCATG
AGGAAGTTGGTCACCAAATATATTTTGTGTAAAGAGAAG
Conceptual translation METANYTKVTEFVLTGLSQTPEVQLVLFVIFLSFYLFILPGNILIICTISLDPHLTSPMY
FLLANLAFLDIWYSSITAPEMLIDFFVERKIISFDGCIAQLFFLHFAGASEMFLLTVMAF
DLYTAICRPLHYATIMNQRLCCILVALSWRGGFIHSIIQVALIVRLPFCGPNELDSYFCD
ITQVVRIACANTFPEELVMICSSGLISVVCLIALLMSYAFLLALFKKLSGSGENTNRAMS
TCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFNTLIFPLRNPIIYTLRNKEVKAAM
RKLVTKYILCKEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 22,368,936 22,368,936 NS A/G N/D rs11857531 (DbSNP)
15 22,369,290 22,369,290 NS A/G M/V rs12593418 (DbSNP)
15 22,369,279 22,369,279 NS C/G T/S rs28678403 (DbSNP)
15 22,369,426 22,369,426 NS G/A R/H rs4087943 (DbSNP)
15 22,368,862 22,368,862 NS G/A G/E rs1835183 (DbSNP)
15 22,369,248 22,369,248 NS T/C F/L rs491208 (DbSNP)
15 22,369,373 22,369,373 SYN A/G S/S rs10048049 (DbSNP)
15 22,369,343 22,369,343 SYN C/T S/S rs11259845 (DbSNP)
15 22,368,738 22,368,738 SYN C/T L/L rs17157554 (DbSNP)
15 22,368,905 22,368,905 SYN G/A S/S rs1835182 (DbSNP)
15 22,081,006 22,081,006 nonsense SNP C/T R/* 1000GP (CEU, CHBJPT)
15 22,081,475 22,081,475 NS G/A R/H 1000GP (CEU, CHBJPT)
15 22,080,954 22,080,954 SYN G/A S/S 1000GP (CEU, CHBJPT)
15 22,080,904 22,080,904 NS T/C F/L 1000GP (CHBJPT)
15 22,080,911 22,080,911 NS G/A G/E 1000GP (CHBJPT)
15 100 -100 SYN C/T L/L 1000GP (YRI, YRI, YRI, YRI)
15 100 -100 NS G/A R/H 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 22,307,069 22,474,088 CopyNumber Variation_2182 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 22,348,218 22,544,992 CopyNumber Variation_4873 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 22,320,036 22,588,036 CopyNumber Variation_8782 (DGV), Variation_34557 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 21,200,251 22,588,036 CopyNumber Variation_8786 (DGV)
15 22,320,057 22,588,019 CopyNumber Variation_9249 (DGV), Variation_34643 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 22,320,057 22,777,875 CopyNumber Variation_9252 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 22,351,239 22,449,059 CopyNumber Variation_9741 (DGV), Variation_10464 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 22,265,649 22,591,752 CopyNumber Variation_37535 (DGV), Variation_37626 (DGV)
15 22,302,006 22,588,022 CopyNumber Variation_38952 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 22,287,131 22,399,235 CopyNumber Variation_59598 (DGV)
15 22,304,940 22,427,590 CopyNumber Variation_72152 (DGV)
15 22,343,976 22,373,055 CopyNumber Variation_72153 (DGV)
15 22,262,185 22,596,129 CopyNumber Variation_72162 (DGV)
15 22,262,185 22,373,349 CopyNumber Variation_72167 (DGV)
15 22,262,145 22,453,425 CopyNumber Variation_76813 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,362,809 22,453,425 CopyNumber Variation_76815 (DGV)
15 22,286,537 22,453,425 CopyNumber Variation_87461 (DGV)
15 21,276,422 22,453,425 CopyNumber Variation_87468 (DGV)
15 22,368,476 22,371,514 CopyNumber #165 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N5D L44R F94L A109V D121N R128* T235S M239V R284C R284H % Freq CORP
1 N L F A D R T M R R 41.71 0.954
2 N L F A D R T M R H 25.65 0.954
3 N L F A D R T V R H 20.51 0.954
4 N L L A D * T M R R 4.38 1.200
5 N L F A D R S M R R 1.31 0.954
6 N L F A D R S M R H 0.77 0.954
7 D L F A D R T M R R 0.77 0.954
8 N L L A D * T M R H 0.69 1.200
9 N L L A D R T M R R 0.69 0.954
10 N L F A D R T V R R 0.61 0.954
11 N L F A D R T M C R 0.61 0.954
12 N L F V D R T M R R 0.46 0.954
13 N L F A D * T M R R 0.46 1.200
14 N L F A D R T M C H 0.31 0.954
15 N L F A N R T M R R 0.23 1.000
16 D L L A D * T M R R 0.15 1.200
17 N L F A D * T M R H 0.15 1.200
18 D L F A D R T M R H 0.08 0.954
19 N R F A D R T V R H 0.08 0.954
20 N L L A D * T V R H 0.08 1.200
21 D L F A D R T V R H 0.08 0.954
22 N L L A D R T M R H 0.08 0.954
23 N L F V N R T M R R 0.08 1.000
24 N L F A D R S V R H 0.08 0.954

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4Q1PandOR4M2andOR4N4.bApr07-unspliced main_exon CDS chr15 22,080,625 22,081,563 +
3UTR chr15 22,081,563 22,081,566 +
OR4Q1PandOR4M2andOR4N4.nApr07 exon_5UTR chr15 22,070,241 22,070,454 +
main_exon chr15 22,080,596 22,080,648 +
main_exon 5UTR chr15 22,080,596 22,080,625 +
CDS_partial chr15 22,080,625 22,080,648 +
CDS_partial chr15 22,080,857 22,081,069 +