Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4N1P Olfactory Receptor

Gene Symbol OR4N1P1 (View this gene in GeneCards)
Family 4
Subfamily N
Pseudogene Yes
CORP pseudogene probability score
Aliases OR14-12, OR14-6, HsOR14.1.6P, ORL3704
External Ids HGNC: 14740   GeneBank: BK004696, BK004715, NG_002243   ORDB: ORL3704   
Build #39 labels OR4N1P
Chromosomal location 14:19,796,336-19,797,284 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4N4 93.95% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4N5 83% 308
Dog OR4N2B 87% 308
Dog OR4N2 86% 301
Chimp CONTIG1808.7-22772 88% 302
Chimp CONTIG794.32-13137 85% 304
Mouse Or4n4b 80% 308
Mouse Or4n4 84% 308
Mouse Or4n5 81% 308
Rat Or4n4 81% 308
Rat Or4n5 81% 308
Cow OR4N2C 88% 306
Cow OR4N4 86% 304
Cow OR4N2 85% 302
Cow OR4N5 83% 304

Expression evidences

Source Accession
GNF Atlas2 gnf1h05681_s_at
GNF Atlas2 gnf1h07263_x_at

Sequence information

Nucleotide sequence GCAGAAGAAATAAAGATAGCAAACAACACAGTAGTGACAGAATTTATCCTCCTTGGTCTG
ACTCAGTCTCAAGATATTCAGCTCTTGGTCTTTGTGCTGATCTTAATTTTCTACCTTATC
ATCCTCCCTGGAAATTTCCTCATCATTTTCACCATAAAGTCAGATCCTGGGCTCACAGCA
CCCCTCTATTTCTTTCTGGGCAACTTGGCCTTCCTGGATGCATCCTACTCCTTCATTGTG
GCTCCCCGGATGTTGGTGGACTTCCTCTCTGCGAAGAATGTAATCTCCTACAGAGGCTGC
ATCACTCAGCTCTTTTTCTTGCACTTCCTTGGAGGAGGAGAGGGATTACTCCTTGTGATG
TAGCCTTTGACCGCTACATCGCCATCTGCCGGCCTCTGCACTATTCTACTCTCATGAACC
CCAGAGCTTGCTATGCAATGATGTTGGCTCTGTGGCTTGGGGGTTTTGTCCACTCCATTA
TCCAGGTGGTCCTCATCCTCCGCTTGCCTTTTTGTGGCCCAAACCAGCTGGACAACTTCT
TCTGTGATGTCCCACAGGTCATCAAGCTGGCTTGCACCGACACGTTTGTGGTGGAGCTTC
TGATGGTCTTCAACAGTGGCCTGATGACACTCCTGTCTTTCTGGGGCTTCTGGCTTCCTA
TGCAGTCATCCTGTGCCATGTTCGTAAGGCAGCTTCTGAATTGAAGAACAAGGCCATGTC
CACGTGCACCACTCATGTCATTATTATACTTCTTATGTTTGGACCTGCTATCTTCATCTA
CATGCACCCCTTCAGGGCCTTACCAGCTGACAAGGTGGTTTCTTTCTTTCACACAGTGAT
CTTTCCATTGATGAATCCTATGATTTATACCCTTGGAAACCAGGAAGTGAAAACTTCCAT
GAAGAGGTTATTGAGTCGACATGTAGTCTGTCAAGTGGACTTTATAATA
Conceptual translation AEEIKIANNTVVTEFILLGLTQSQDIQLLVFVLILIFYLIILPGNFLIIFTIKSDPGLTA
PLYFFLGNLAFLDASYSFIVAPRMLVDFLSAKNVISYRGCITQLFFLHFLGGGEGLLLV/br/>SVAFDRYIAICRPLHYSTLMNPRACYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDN
FFCDVPQVIKLACTDTFVVELLMVFNSGLMTLL/FLGLLASYAVILCHVRKAASELKNK
AMSTCTTHVIIILLMFGPAIFIYMHPFRALPADKVVSFFHTVIFPLMNPMIYTLGNQEVK
TSMKRLLSRHVVCQVDFII

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,264,674 20,264,674 SNP A/C rs60978345 (DbSNP)
14 20,264,912 20,264,912 SNP A/G rs17114258 (DbSNP)
14 20,265,201 20,265,201 SNP A/G rs17276836 (DbSNP)
14 20,264,506 20,264,506 SNP A/G rs61031795 (DbSNP)
14 20,265,265 20,265,265 SNP A/T rs12100572 (DbSNP)
14 20,265,369 20,265,369 SNP C/G rs2489769 (DbSNP)
14 20,264,665 20,264,665 SNP C/G rs58495514 (DbSNP)
14 20,265,145 20,265,145 SNP C/T rs61480880 (DbSNP)
14 20,264,814 20,264,814 SNP G/T rs72663723 (DbSNP)
14 19,796,516 19,796,516 SNP C/. 1000GP (CEU, CHBJPT)
14 19,797,042 19,797,042 SNP A/G 1000GP (CEU, CHBJPT)
14 19,797,106 19,797,106 SNP T/A 1000GP (CEU)
14 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,197,616 20,399,048 CopyNumber Variation_0316 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,080,166 20,271,356 CopyNumber Variation_4824 (DGV)
14 20,219,649 20,415,445 CopyNumber Variation_4826 (DGV)
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,239,479 20,422,583 CopyNumber Variation_8764 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,239,479 20,511,107 CopyNumber Variation_9235 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,239,246 20,432,988 CopyNumber Variation_34659 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 19,670,757 20,331,117 CopyNumber Variation_37621 (DGV)
14 20,200,183 20,423,372 CopyNumber Variation_38951 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 20,255,784 20,265,670 CopyNumber Variation_71831 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,263,747 20,314,312 CopyNumber Variation_71834 (DGV)
14 20,198,061 20,307,453 CopyNumber Variation_71859 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,185,336 20,310,638 CopyNumber Variation_76557 (DGV)
14 20,201,654 20,343,302 CopyNumber Variation_87118 (DGV)
CopyNumber 196 (Hasin)
14 20,264,395 20,267,443 CopyNumber #156 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.