Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4N4 Olfactory Receptor

Gene Symbol OR4N41 (View this gene in GeneCards)
Family 4
Subfamily N
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR15-5, OR15-1, HsOR15.1.9, ORL3721, ORL3722
External Ids HGNC: 15375   GeneBank: AB065653, AB065904, BK004406, BK004479, NM_001005241   ORDB: ORL3721, ORL3722   
Build #39 labels OR4N4
Chromosomal location 15:22,094,522-22,095,469 (+)
Cluster 15@22
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4N1P 93.95% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4N2 86% 305
Dog OR4N5 84% 308
Dog OR4N2B 88% 308
Chimp CONTIG1808.7-22772 87% 306
Chimp CONTIG794.32-13137 83% 308
Mouse Or4n4b 82% 308
Mouse Or4n4 85% 308
Mouse Or4n5 81% 308
Rat Or4n4 82% 308
Rat Or4n5 82% 308
Cow OR4N2 86% 306
Cow OR4N2C 89% 306
Cow OR4N5 83% 308

Expression evidences

Source Accession
ESTs GD259804
mRNA DQ786223

Sequence information

Nucleotide sequence ATGAAGATAGCAAACAACACAGTAGTGACAGAATTTATCCTCCTTGGTCTGACTCAGTCT
CAAGATATTCAGCTCTTGGTCTTTGTGCTGATCTTAATTTTCTACCTTATCATCCTCCCT
GGAAATTTTCTCATTATTTTCACCATAAGGTCAGACCCTGGGCTCACAGCCCCCCTCTAT
TTATTTCTGGGCAACTTGGCCTTCCTGGATGCATCCTACTCCTTCATTGTGGCTCCCAGG
ATGTTGGTGGACTTCCTCTCTGAGAAAAAGGTAATCTCCTACAGAGGCTGCATCACTCAG
CTCTTTTTCTTGCACTTCCTTGGAGGAGGGGAGGGATTACTCCTTGTTGTGATGGCCTTT
GACCGCTACATCGCCATCTGCCGGCCTCTGCACTGTTCAACTGTCATGAACCCTAGAGCC
TGCTATGCAATGATGTTGGCTCTGTGGCTTGGGGGTTTTGTCCACTCCATTATCCAGGTG
GTCCTCATCCTCCGCTTGCCTTTTTGTGGCCCAAACCAGCTGGACAACTTCTTCTGTGAT
GTCCGACAGGTCATCAAGCTGGCTTGCACCGACATGTTTGTGGTGGAGCTTCTAATGGTC
TTCAACAGTGGCCTGATGACACTCCTGTGCTTTCTGGGGCTTCTGGCTTCCTATGCAGTC
ATCCTCTGCCATGTTCGTAGGGCAGCTTCTGAAGGGAAGAACAAGGCCATGTCCACGTGC
ACCACTCGTGTCATTATTATACTTCTTATGTTTGGACCTGCTATCTTCATCTACATGTGC
CCTTTCAGGGCCTTACCAGCTGACAAGATGGTTTCTCTCTTTCACACAGTGATCTTTCCA
TTGATGAATCCTATGATTTATACCCTTCGCAACCAGGAAGTGAAAACTTCCATGAAGAGG
TTATTGAGTCGACATGTAGTCTGTCAAGTGGATTTTATAATAAGAAAC
Conceptual translation MKIANNTVVTEFILLGLTQSQDIQLLVFVLILIFYLIILPGNFLIIFTIRSDPGLTAPLY
LFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHCSTVMNPRACYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD
VRQVIKLACTDMFVVELLMVFNSGLMTLLCFLGLLASYAVILCHVRRAASEGKNKAMSTC
TTRVIIILLMFGPAIFIYMCPFRALPADKMVSLFHTVIFPLMNPMIYTLRNQEVKTSMKR
LLSRHVVCQVDFIIRN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 100 -100 SYN G/A T/T 1000GP (YRI)
15 22,095,238 22,095,238 SYN G/A T/T 1000GP (CEU, CHBJPT)
15 22,095,298 22,095,298 NS G/A M/I 1000GP (CEU)
15 22,382,655 22,382,655 NS A/C L/F rs535034 (DbSNP)
15 22,382,704 22,382,704 NS C/G P/A rs62006708 (DbSNP)
15 22,382,728 22,382,728 NS C/T L/F rs2808136 (DbSNP)
15 22,382,739 22,382,739 SYN G/A K/K rs2671839 (DbSNP)
15 22,382,821 22,382,821 NS C/G L/V rs12438969 (DbSNP)
15 22,382,828 22,382,828 NS A/C D/A rs62006709 (DbSNP)
15 22,382,897 22,382,897 NS A/G Y/C rs62006710 (DbSNP)
15 22,383,064 22,383,064 NS A/C I/L rs12441468 (DbSNP)
15 22,383,066 22,383,066 SYN A/G L/L rs559754 (DbSNP)
15 22,383,066 22,383,068 mnp CAT/TAG rs67576397 (DbSNP)
15 22,383,149 22,383,149 NS A/G H/R rs74002754 (DbSNP)
15 22,383,188 22,383,188 NS T/C M/T rs475947 (DbSNP)
15 22,383,189 22,383,189 SYN A/G T/T rs1820851 (DbSNP)
15 22,383,292 22,383,292 NS T/C F/L rs3817271 (DbSNP)
15 22,383,405 22,383,405 SYN C/T D/D rs74002755 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 21,200,251 22,588,036 CopyNumber Variation_8786 (DGV)
15 21,276,422 22,453,425 CopyNumber Variation_87468 (DGV)
15 21,362,809 22,453,425 CopyNumber Variation_76815 (DGV)
15 22,262,145 22,453,425 CopyNumber Variation_76813 (DGV)
15 22,262,185 22,596,129 CopyNumber Variation_72162 (DGV)
15 22,265,649 22,591,752 CopyNumber Variation_37535 (DGV), Variation_37626 (DGV)
15 22,286,537 22,453,425 CopyNumber Variation_87461 (DGV)
15 22,287,131 22,399,235 CopyNumber Variation_59598 (DGV)
15 22,302,006 22,588,022 CopyNumber Variation_38952 (DGV)
15 22,304,940 22,427,590 CopyNumber Variation_72152 (DGV)
15 22,307,069 22,474,088 CopyNumber Variation_2182 (DGV)
15 22,320,036 22,588,036 CopyNumber Variation_8782 (DGV), Variation_34557 (DGV)
15 22,320,057 22,588,019 CopyNumber Variation_9249 (DGV), Variation_34643 (DGV)
15 22,320,057 22,777,875 CopyNumber Variation_9252 (DGV)
15 22,348,218 22,544,992 CopyNumber Variation_4873 (DGV)
15 22,351,239 22,449,059 CopyNumber Variation_9741 (DGV), Variation_10464 (DGV)
15 22,370,110 22,383,638 CopyNumber Variation_72155 (DGV)
15 22,372,655 22,384,026 CopyNumber Variation_23197 (DGV)
15 22,372,924 22,453,425 CopyNumber Variation_87464 (DGV)
15 22,382,373 22,385,420 Deletion, CopyNumber #302 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A78P L86F V117L A119D R128W C132Y Y142C L198I R226H T239M M259I F274L R304Q % Freq CORP
1 A L V A R C Y L R T M F R 53.23 1.000
2 P L V A R C C L R T M F R 14.82 1.000
3 A F L D R C Y I R T M F R 9.06 1.000
4 A F L A R C Y I R T M F R 5.22 1.000
5 A F L D R C Y L R T M F R 3.07 1.000
6 A L V A R C C L R T M F R 1.46 1.000
7 A L V A R C Y L R T M L R 1.46 1.000
8 A F L A R C Y L R T M F R 1.31 1.000
9 A L L A R C Y I R T M F R 1.08 1.000
10 A L L D R C Y L R T M F R 0.92 1.000
11 A F V A R C Y L R T M F R 0.84 1.000
12 A L V A W Y Y L R T M F R 0.84 0.937
13 A L V A R C Y I R T M F R 0.77 1.000
14 P L V A R C Y L R T M F R 0.69 1.000
15 A F V A R C Y I R T M F R 0.69 1.000
16 A L V A W Y Y L H T M F Q 0.61 0.937
17 A L V A R C Y L R T I F R 0.61 1.000
18 A L L D R C Y I R T M F R 0.54 1.000
19 A L L A R C Y L R T M F R 0.31 1.000
20 P L V A R C C L R T I F R 0.15 1.000
21 A L L A W Y Y L R T M F R 0.15 0.937
22 A L V A W Y Y L R M M F R 0.15 0.982
23 A F V A W Y Y L R T M F R 0.15 0.937
24 A L V A R C Y L H T M F R 0.15 1.000
25 A F L D R C C L R T M F R 0.15 1.000
26 A L V D R C Y L R T M F R 0.15 1.000
27 P L V A R C C L R T M L R 0.08 1.000
28 P L L D R C C L R T M F R 0.08 1.000
29 A F V A R C Y L H T M F Q 0.08 1.000
30 A F L D W Y Y L H T M F Q 0.08 0.957
31 A F V A R C Y L R M M F R 0.08 1.000
32 A F V A W Y Y I R T M F R 0.08 0.937
33 A F V A R C Y L H T M F R 0.08 1.000
34 A F V A W Y Y L H T M F Q 0.08 0.937
35 A L V A R C C L R T M L R 0.08 1.000
36 A F L A R C Y L R M M F R 0.08 1.000
37 P F L A R C Y I R T M F R 0.08 1.000
38 A F V A W Y Y L R M M F R 0.08 0.982
39 A F L A R C C L R T M F R 0.08 1.000
40 A L V A W Y Y L R T M F Q 0.08 0.937
41 A F L D R C Y I H T M F R 0.08 1.000
42 A F L D R C Y I R T M L R 0.08 1.000
43 P L V A W Y C L R T M F R 0.08 0.937
44 P L V A W Y C L H T M F Q 0.08 0.937

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4Q1PandOR4M2andOR4N4.aApr07 exon_5UTR chr15 22,015,234 22,015,331 +
exon_5UTR chr15 22,030,926 22,031,020 +
exon_5UTR chr15 22,044,437 22,044,825 +
exon_5UTR chr15 22,058,721 22,058,816 +
exon_5UTR chr15 22,059,321 22,059,409 +
exon_5UTR chr15 22,059,632 22,059,835 +
main_exon 5UTR chr15 22,094,513 22,094,522 +
CDS chr15 22,094,522 22,095,469 +
3UTR chr15 22,095,469 22,095,864 +