Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4N5 Olfactory Receptor

Gene Symbol OR4N51 (View this gene in GeneCards)
Family 4
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.45 (functional)
Aliases OR14-33, HsOR14.1.23, ORL3685
External Ids HGNC: 15358   GeneBank: AB065890, BK004451, NM_001004724   ORDB: ORL3685   
Build #39 labels OR4N5
Chromosomal location 14:20,143,736-20,144,659 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4N1P 83.88% 304
OR4N2 84.64% 306
OR4N4 83.77% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4N5 89% 308
Chimp CONTIG794.32-13137 98% 308
Mouse Or4n5 86% 308
Mouse Or4n4 81% 308
Rat Or4n5 87% 308
Cow OR4N5 89% 308
Cow OR4N4 87% 308
Cow OR4N2C 86% 307

Sequence information

Nucleotide sequence ATGGAAACACAGAACCTCACAGTGGTGACAGAATTCATTCTTCTTGGTCTGACCCAGTCT
CAAGATGCTCAACTTCTGGTCTTTGTGCTAGTCTTAATTTTCTACCTTATCATCCTCCCT
GGAAATTTCCTCATCATTTTCACCATAAAGTCAGACCCTGGGCTCACAGCCCCCCTCTAT
TTCTTTCTGGGCAACTTGGCCTTACTGGATGCATCCTACTCCTTCATTGTGGTTCCCAGG
ATGTTGGTGGACTTCCTCTCTGAGAAGAAGGTAATCTCCTATAGAAGCTGCATCACTCAG
CTCTTTTTCTTGCATTTTCTTGGAGCGGGAGAGATGTTCCTCCTCGTTGTGATGGCCTTT
GACCGCTACATCGCCATCTGCCGGCCTTTACACTATTCAACCATCATGAACCCTAGAGCC
TGCTATGCATTATCGTTGGTTCTGTGGCTTGGGGGCTTTATCCATTCCATTGTACAAGTA
GCCCTTATCCTGCACTTGCCTTTCTGTGGCCCAAACCAGCTCGATAACTTCTTCTGTGAT
GTTCCACAGGTCATCAAGCTGGCCTGCACCAATACCTTTGTGGTGGAGCTTCTGATGGTC
TCCAACAGTGGCCTGCTCAGCCTCCTGTGCTTCCTGGGCCTTCTGGCCTCCTATGCAGTC
ATCCTCTGTCGTATAAGGGAGCACTCCTCTGAAGGAAAGAGCAAGGCTATTTCCACATGC
ACCACCCATATTATCATTATATTTCTCATGTTTGGACCTGCTATTTTCATCTACACTTGC
CCCTTCCAGGCTTTCCCAGCTGACAAGGTAGTTTCTCTTTTCCATACTGTCATCTTTCCT
TTGATGAACCCTGTTATTTATACGCTTCGCAACCAGGAGGTGAAAGCTTCCATGAGGAAG
TTGTTAAGTCAACATATGTTTTGC
Conceptual translation METQNLTVVTEFILLGLTQSQDAQLLVFVLVLIFYLIILPGNFLIIFTIKSDPGLTAPLY
FFLGNLALLDASYSFIVVPRMLVDFLSEKKVISYRSCITQLFFLHFLGAGEMFLLVVMAF
DRYIAICRPLHYSTIMNPRACYALSLVLWLGGFIHSIVQVALILHLPFCGPNQLDNFFCD
VPQVIKLACTNTFVVELLMVSNSGLLSLLCFLGLLASYAVILCRIREHSSEGKSKAISTC
TTHIIIIFLMFGPAIFIYTCPFQAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRK
LLSQHMFC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,612,300 20,612,299 Ins(1) -/C rs36058896 (DbSNP)
14 20,612,267 20,612,267 NS A/G T/A rs74033809 (DbSNP)
14 20,612,763 20,612,763 NS A/G H/R rs10141025 (DbSNP)
14 20,612,465 20,612,465 NS A/G N/D rs10131326 (DbSNP)
14 20,612,286 20,612,286 NS A/G H/R rs55660957 (DbSNP)
14 20,612,595 20,612,595 NS C/G T/S rs10140908 (DbSNP)
14 20,612,672 20,612,672 NS C/T R/C rs10134472 (DbSNP)
14 20,611,974 20,611,974 NS G/T G/V rs11622442 (DbSNP)
14 20,612,158 20,612,158 SYN A/G E/E rs28408764 (DbSNP)
14 20,612,290 20,612,290 SYN C/T Y/Y rs17308206 (DbSNP)
14 20,612,605 20,612,605 SYN C/T I/I rs10134379 (DbSNP)
14 20,143,999 20,143,999 SYN G/A E/E 1000GP (CHBJPT)
14 20,144,108 20,144,108 NS G/A A/T 1000GP (CHBJPT)
14 20,144,131 20,144,131 SYN T/C Y/Y 1000GP (CHBJPT)
14 20,144,186 20,144,186 NS G/T G/W 1000GP (CHBJPT)
14 20,144,257 20,144,257 SYN C/T L/L 1000GP (CHBJPT)
14 20,144,306 20,144,306 NS A/G N/D 1000GP (CHBJPT)
14 20,144,436 20,144,436 NS G/C S/T 1000GP (CHBJPT)
14 20,144,446 20,144,446 SYN T/C I/I 1000GP (CHBJPT)
14 20,144,513 20,144,513 NS T/C C/R 1000GP (CHBJPT)
14 20,144,604 20,144,604 NS G/A R/H 1000GP (CHBJPT)
14 100 -100 SYN G/A E/E 1000GP (YRI, YRI, YRI)
14 100 -100 NS G/A A/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A125T H131R N191D R224H S234T C260R C260F T288M R290H F307L % Freq CORP
1 A H N R S C C T R F 95.47 0.551
2 T H D R T R C T H F 2.00 1.000
3 A R N R S C C T R F 1.69 0.551
4 A H N R S C C M R F 0.38 0.551
5 T H D H T R C T H F 0.15 1.000
6 A R N R S C F T R F 0.15 0.551
7 A H N R S C F T R F 0.08 0.551
8 A H N R S C C T R L 0.08 0.551

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4N5.aApr07-unspliced main_exon CDS chr14 20,143,736 20,144,659 +
3UTR chr14 20,144,659 20,144,662 +