Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4P4 Olfactory Receptor

Gene Symbol OR4P41 (View this gene in GeneCards)
Family 4
Subfamily P
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases HsOR11.11.18, ORL3311
External Ids HGNC: 15180   GeneBank: AB065775, AF399448, NM_001004124   ORDB: ORL3311   
Build #39 labels OR4P4, OR4P3P
Chromosomal location 11:55,638,337-55,639,293 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4P1P 73.7% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4P4 85% 314
Chimp CONTIG970.69-8181 98% 319
Mouse Or4p4 87% 307
Mouse Or4p4b-ps 84% 309
Rat Or4p4 86% 307
Cow OR4P7 75% 301

Sequence information

Nucleotide sequence ATGTTCTATCTACACTGGACCATGGAAAAAAGCAATAATAGCACTTTGTTTATTCTCTTG
GGGTTTTCCCAAAATAAGAACATTGAAGTCCTCTGCTTTGTATTATTTTTGTTTTGCTAC
ATTGCTATTTGGATGGGAAACTTACTCATAATGATTTCTATCACGTGCACCCAGCTCATT
CACCAACCCATGTATTTCTTCCTCAATTACCTCTCACTCTCCGACCTTTGCTACACATCC
ACAGTGACCCCCAAATTAATGGTTGACTTACTGGCAGAAAGAAAGACCATTTCCTATAAT
AACTGTATGATACAACTCTTTACCACCCATTTTTTTGGAGGCATAGAGATCTTCATTCTC
ACAGGGATGGCCTATGACCGCTATGTGGCCATTTGCAAGCCCCTGCACTACACCATTATT
ATGAGCAGGCAAAAGTGTAACACAATCATCATAGTTTGTTGTACTGGGGGATTTATACAT
TCTGCCAGTCAGTTTCTTCTCACCATCTTTGTACCATTTTGTGGCCCAAATGAGATAGAT
CACTACTTCTGTGATGTGTATCCTTTGCTGAAATTGGCCTGTTCTAATATACACATGATA
GGTCTCTTAGTCATTGCTAATTCAGGCTTAATTGCTTTGGTGACATTTGTTGTCTTGTTG
TTGTCTTATGTTTTTATATTGTATACCATCAGAGCATACTCTGCAGAGAGACGCAGCAAA
GCTCTTGCCACTTGTAGTTCTCATGTAATTGTTGTGGTCCTGTTTTTTGCACCTGCATTG
TTCATTTACATTAGACCGGTCACAACATTCTCAGAAGATAAAGTGTTTGCCCTTTTTTAT
ACCATCATTGCTCCCATGTTCAACCCTCTCATATACACGCTGAGAAACACAGAGATGAAG
AACGCCATGAGGAAAGTGTGGTGTTGTCAAATACTCCTGAAAAGAAATCAACTTTTC
Conceptual translation MFYLHWTMEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLI
HQPMYFFLNYLSLSDLCYTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFIL
TGMAYDRYVAICKPLHYTIIMSRQKCNTIIIVCCTGGFIHSASQFLLTIFVPFCGPNEID
HYFCDVYPLLKLACSNIHMIGLLVIANSGLIALVTFVVLLLSYVFILYTIRAYSAERRSK
ALATCSSHVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMFNPLIYTLRNTEMK
NAMRKVWCCQILLKRNQLF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,406,524 55,406,524 NS C/T R/C rs61896975 (DbSNP)
11 55,406,686 55,406,686 NS G/T D/Y rs73469483 (DbSNP)
11 55,406,562 55,406,562 NS G/T M/I rs57403436 (DbSNP)
11 55,406,280 55,406,280 SYN A/G G/G rs55694932 (DbSNP)
11 55,406,031 55,406,031 SYN C/G L/L rs60079577 (DbSNP)
11 55,638,546 55,638,546 nonsense SNP C/G Y/* 1000GP (CEU, CHBJPT)
11 55,639,048 55,639,048 NS C/T R/C 1000GP (CEU)
11 100 -100 nonsense SNP C/G Y/* 1000GP (YRI)
11 100 -100 SYN G/A G/G 1000GP (YRI, YRI)
11 100 -100 NS T/G I/M 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,359,025 55,470,359 CopyNumber Variation_0419 (DGV), Variation_34977 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,382,681 55,548,038 CopyNumber Variation_4743 (DGV)
11 55,367,167 55,452,993 CopyNumber Variation_6923 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,371,021 55,422,586 CopyNumber Variation_9662 (DGV), Variation_48831 (DGV)
11 55,360,213 55,447,427 CopyNumber Variation_9663 (DGV), Variation_48827 (DGV)
11 55,371,021 55,447,427 CopyNumber Variation_10359 (DGV), Variation_48834 (DGV), Variation_48835 (DGV)
11 55,371,021 55,418,182 CopyNumber Variation_10361 (DGV), Variation_48830 (DGV), Variation_53101 (DGV)
11 55,364,237 55,431,910 Inversion Variation_29474 (DGV)
11 55,360,213 55,447,426 CopyNumber Variation_29606 (DGV)
11 55,371,020 55,460,788 CopyNumber Variation_29910 (DGV)
11 55,367,884 55,459,183 CopyNumber Variation_31823 (DGV)
11 55,362,651 55,460,561 CopyNumber Variation_34978 (DGV)
11 55,358,496 55,434,466 CopyNumber Variation_37484 (DGV)
11 55,374,032 55,453,009 CopyNumber Variation_38079 (DGV)
11 55,368,154 55,450,788 CopyNumber Variation_38972 (DGV)
11 55,365,425 55,431,552 CopyNumber Variation_41253 (DGV)
11 55,335,878 55,453,486 CopyNumber Variation_48051 (DGV)
11 55,381,588 55,474,194 CopyNumber Variation_48053 (DGV)
11 55,360,213 55,442,368 CopyNumber Variation_48826 (DGV)
11 55,360,213 55,470,003 CopyNumber Variation_48828 (DGV)
11 55,371,021 55,408,700 CopyNumber Variation_48829 (DGV)
11 55,371,021 55,437,126 CopyNumber Variation_48832 (DGV)
11 55,371,021 55,442,368 CopyNumber Variation_48833 (DGV)
11 55,371,021 55,460,095 CopyNumber Variation_48836 (DGV)
11 55,383,157 55,447,427 CopyNumber Variation_48837 (DGV), Variation_53573 (DGV)
11 55,396,041 55,408,700 CopyNumber Variation_48838 (DGV)
11 55,396,041 55,442,368 CopyNumber Variation_48839 (DGV)
11 55,339,829 55,447,427 CopyNumber Variation_53140 (DGV)
11 55,360,213 55,490,377 CopyNumber Variation_53507 (DGV)
11 55,360,213 55,460,788 CopyNumber Variation_53994 (DGV)
11 55,360,213 55,470,994 CopyNumber Variation_54018 (DGV)
11 55,364,677 55,453,061 CopyNumber Variation_65955 (DGV)
11 55,366,131 55,452,023 CopyNumber Variation_75644 (DGV)
11 55,365,707 55,452,023 CopyNumber Variation_85779 (DGV)
Deletion 253 (Hasin)
11 55,405,713 55,408,769 Deletion #15 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y63* R231C I243M Y285D R297K % Freq CORP
1 Y R I Y R 75.50 0.676
2 * R I Y R 17.13 1.200
3 Y C I Y R 3.53 0.676
4 Y R M Y R 1.92 0.676
5 Y R I D R 1.69 0.676
6 Y R I Y K 0.23 0.676

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4P4.aApr07-unspliced main_exon CDS_partial chr11 55,638,358 55,639,293 +
3UTR chr11 55,639,293 55,639,296 +