Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4Q3 Olfactory Receptor

Gene Symbol OR4Q31 (View this gene in GeneCards)
Family 4
Subfamily Q
Pseudogene No
CORP pseudogene probability score 0.17 (functional)
Aliases OR14-3, HsOR14.1.3, ORL3814
External Ids HGNC: 15426   GeneBank: AB065609, AF179768, BK004488, NM_172194   ORDB: ORL3814   
Build #39 labels OR4Q3, OR4Q4
Chromosomal location 14:19,747,428-19,748,366 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4Q1P 93.59% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4Q3 88% 305
Dog OR4Q3B 86% 305
Chimp CONTIG*********** 59% 305
Chimp CONTIG794.32-13137 57% 302
Chimp CONTIG708.114-14757 57% 302
Mouse Or4q3 82% 304
Rat Or4q3-ps 79% 304
Cow OR4Q3 88% 305

Expression evidences

Source Accession
mRNA AB463966
GNF Atlas2 gnf1h02183_at

Sequence information

Nucleotide sequence ATGAAAAAAGAACAAGATTCTAATGTGACAGAATTTGTTCTTCTGGGCCTATCATCTTCT
TGGGAGCTGCAGCTATTTCTCTTCTTACTATTTTTGTTTTTTTACATTGCTATTGTCCTG
GGAAACCTCTTGATAGTGGTAACAGTGCAAGCCCATGCTCACCTGCTCCAATCTCCTATG
TATTATTTTTTAGGTCATCTCTCTTTCATTGACCTATGCCTGAGCTGTGTTACTGTGCCA
AAGATGTTAGGGGATTTCCTACAGCAGGGCAAGAGCATCTCTTTTTCAGGATGCCTGGCC
CAGATCTACTTCCTCCACTTTCTAGGAGCCAGTGAGATGTTTTTGCTGACAGTCATGGCC
TATGACAGGTATGTTGCCATCTGTAACCCTTTGCGCTACCTTACAGTCATGAACCCCCAG
CTATGCCTTTGGTTGGTTCTTGCCTGCTGGTGTGGGGGTTTTATCCACTCTATCATGCAG
GTCATACTAGTCATCCAGCTGCCTTTCTGTGGGCCCAATGAACTGGACAACTTCTACTGT
GATGTCCCACAAGTCATCAAGCTGGCCTGCATGGACACCTATGTGGTAGAGGTGCTGGTG
ATAGCCAACAGTGGTCTGCTGTCTCTTGTCTGCTTCTTGGTCTTACTATTCTCTTATGCT
ATCATCCTGATCACCCTGAGAACACACTTCTGCCAGGGCCAGAACAAGGTCTTCTCTACC
TGTGCTTCTCACCTGACAGTGGTCAGCCTGATCTTCGTGCCATGCGTATTCATCTATTTG
AGGCCTTTCTGCAGCTTCTCTGTGGATAAGATATTCTCCTTGTTTTACACAGTGATTACA
CCTATGTTGAACCCCCTCATCTACACACTCAGAAATACTGATATGAAGACAGCTATGAAG
AAGCTGAGGATAAAACCATGTGGCATTCCATTGCCTTGT
Conceptual translation MKKEQDSNVTEFVLLGLSSSWELQLFLFLLFLFFYIAIVLGNLLIVVTVQAHAHLLQSPM
YYFLGHLSFIDLCLSCVTVPKMLGDFLQQGKSISFSGCLAQIYFLHFLGASEMFLLTVMA
YDRYVAICNPLRYLTVMNPQLCLWLVLACWCGGFIHSIMQVILVIQLPFCGPNELDNFYC
DVPQVIKLACMDTYVVEVLVIANSGLLSLVCFLVLLFSYAIILITLRTHFCQGQNKVFST
CASHLTVVSLIFVPCVFIYLRPFCSFSVDKIFSLFYTVITPMLNPLIYTLRNTDMKTAMK
KLRIKPCGIPLPC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,215,674 20,215,674 NS A/C I/L rs4494468 (DbSNP)
14 20,215,989 20,215,989 NS A/G T/A rs17210864 (DbSNP)
14 20,215,779 20,215,779 NS A/G S/G rs4412904 (DbSNP)
14 20,216,298 20,216,298 NS C/T L/F rs12896533 (DbSNP)
14 20,216,404 20,216,404 NS C/T S/F rs45516108 (DbSNP)
14 20,215,637 20,215,637 SYN A/G L/L rs28652816 (DbSNP)
14 19,747,830 19,747,830 NS A/G T/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
14 20,197,616 20,399,048 CopyNumber Variation_0316 (DGV)
14 20,203,125 20,539,108 CopyNumber Variation_3036 (DGV)
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,080,166 20,271,356 CopyNumber Variation_4824 (DGV)
14 20,095,109 20,231,601 CopyNumber Variation_4825 (DGV)
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 20,203,125 20,483,660 CopyNumber Variation_8762 (DGV)
14 20,203,125 20,626,160 CopyNumber Variation_8763 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)
14 20,203,125 20,433,044 CopyNumber Variation_9234 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 20,203,125 20,525,833 CopyNumber Variation_34547 (DGV)
14 20,203,125 20,456,434 CopyNumber Variation_34575 (DGV)
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,550,348 CopyNumber Variation_34660 (DGV)
14 20,203,125 20,455,307 CopyNumber Variation_34664 (DGV)
14 19,670,757 20,331,117 CopyNumber Variation_37621 (DGV)
14 20,200,183 20,423,372 CopyNumber Variation_38951 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 20,194,500 20,255,301 CopyNumber Variation_71832 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,198,061 20,307,453 CopyNumber Variation_71859 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,185,336 20,310,638 CopyNumber Variation_76557 (DGV)
14 20,179,862 20,261,582 CopyNumber Variation_87116 (DGV)
14 20,196,206 20,245,238 CopyNumber Variation_87117 (DGV)
14 20,201,654 20,343,302 CopyNumber Variation_87118 (DGV)
CopyNumber 118 (Hasin)
14 20,215,487 20,218,525 CopyNumber #159 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T135A Q184H F238L V256I Y259C % Freq CORP
1 T Q L V Y 62.44 0.342
2 T Q F V Y 30.11 0.342
3 A Q L V Y 6.30 0.342
4 A Q F V Y 0.84 0.342
5 T Q L I Y 0.15 0.342
6 T Q F V C 0.08 0.342
7 T H F V Y 0.08 0.342

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4Q3.aApr07-unspliced main_exon CDS chr14 19,747,428 19,748,366 +
3UTR chr14 19,748,366 19,748,369 +