Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4S1 Olfactory Receptor

Gene Symbol OR4S11 (View this gene in GeneCards)
Family 4
Subfamily S
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases OR11-100, HsOR11.8.5, ORL3737
External Ids HGNC: 14705   GeneBank: AB065908, BK004348, NM_001004725   ORDB: ORL3737   
Build #39 labels OR4S1
Chromosomal location 11:48,306,223-48,307,149 (+)
Cluster 11@48
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4C10P 55.02% 309
OR4C3 55.67% 300
OR4S2 60.47% 296

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4S1 89% 309
Dog OR4S1B 86% 309
Chimp CONTIG1131.64-4404 97% 309
Mouse Or4s2 60% 305
Rat Or4s2 59% 305
Cow OR4S1 86% 305

Expression evidences

Source Accession
GNF Atlas2 gnf1h02091_at

Sequence information

Nucleotide sequence ATGGGTGCCAAGAACAATGTGACTGAGTTTGTTTTATTTGGCCTTTTTGAGAGCAGAGAG
ATGCAGCATACATGCTTTGTGGTATTCTTCCTCTTTCATGTGCTCACTGTCCTGGGGAAC
CTTCTGGTCATCATCACCATCAATGCTAGAAAGACCCTGAAGTCTCCCATGTATTTCTTC
CTGAGCCAGTTGTCTTTTGCTGACATATGTTATCCATCCACTACCATACCCAAGATGATT
GCTGACACTTTTGTGGAGCATAAGATCATCTCCTTCAATGGCTGCATGACCCAGCTCTTT
TCTGCCCACTTCTTTGGTGGCACTGAGATCTTCCTCCTTACAGCCATGGCCTATGACCGC
TATGTGGCCATCTGTAGGCCCCTGCACTACACAGCCATCATGGATTGCCGGAAGTGTGGC
CTGCTAGCGGGGGCCTCCTGGTTAGCTGGCTTCCTGCATTCCATCCTGCAGACCCTCCTC
ACGGTTCAGCTGCCTTTTTGTGGGCCCAATGAGATAGACAACTTCTTCTGTGATGTTCAT
CCCCTGCTCAAGTTGGCCTGTGCAGACACCTACATGGTAGGTCTCATCGTGGTGGCCAAC
AGCGGTATGATTTCTTTAGCATCCTTTTTTATCCTTATCATTTCCTATGTTATCATCTTA
CTGAACCTAAGAAGCCAGTCATCTGAGGACCGGCGTAAGGCTGTCTCCACATGTGGCTCA
CACGTAATCACTGTCCTTTTGGTTCTCATGCCCCCCATGTTCATGTACATTCGTCCCTCC
ACCACCCTGGCTGCTGACAAACTTATCATCCTCTTTAACATTGTGATGCCACCTTTGCTG
AACCCTTTGATCTATACACTAAGGAACAACGATGTGAAAAATGCCATGAGGAAGCTGTTT
AGGGTCAAGAGGAGCTTAGGGGAGAAG
Conceptual translation MGAKNNVTEFVLFGLFESREMQHTCFVVFFLFHVLTVLGNLLVIITINARKTLKSPMYFF
LSQLSFADICYPSTTIPKMIADTFVEHKIISFNGCMTQLFSAHFFGGTEIFLLTAMAYDR
YVAICRPLHYTAIMDCRKCGLLAGASWLAGFLHSILQTLLTVQLPFCGPNEIDNFFCDVH
PLLKLACADTYMVGLIVVANSGMISLASFFILIISYVIILLNLRSQSSEDRRKAVSTCGS
HVITVLLVLMPPMFMYIRPSTTLAADKLIILFNIVMPPLLNPLIYTLRNNDVKNAMRKLF
RVKRSLGEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 48,327,947 48,327,947 NS A/G Y/C rs11601697 (DbSNP)
11 48,328,184 48,328,184 NS A/G Q/R rs61749289 (DbSNP)
11 48,328,639 48,328,639 NS A/G N/D rs61730866 (DbSNP)
11 48,328,193 48,328,193 NS C/G A/G rs61749290 (DbSNP)
11 48,328,121 48,328,121 NS C/T T/M rs35930119 (DbSNP)
11 48,327,841 48,327,841 NS C/T H/Y rs61745904 (DbSNP)
11 48,327,834 48,327,834 NS G/T E/D rs61745901 (DbSNP)
11 48,328,644 48,328,644 SYN C/T N/N rs753095 (DbSNP)
11 48,307,092 48,307,092 SYN C/T N/N 1000GP (CEU, CHBJPT)
11 48,306,569 48,306,569 NS T/C M/T 1000GP (CEU)
11 48,306,546 48,306,546 SYN T/C T/T 1000GP (CEU)
11 100 -100 NS G/T V/L 1000GP (YRI)
11 100 -100 SYN C/T N/N 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 48,303,671 48,863,606 CopyNumber Variation_3848 (DGV)
11 48,327,709 48,328,760 CopyNumber Variation_30549 (DGV)
11 48,327,960 48,328,962 CopyNumber Variation_85759 (DGV)
11 48,327,710 48,327,997 InDel Variation_11051 (DGV)
11 48,327,528 48,328,240 InDel Variation_58520 (DGV)
11 48,327,672 48,328,178 InDel Variation_65938 (DGV)
11 48,328,162 48,328,262 InDel Variation_75635 (DGV)
11 48,328,182 48,328,342 InDel Variation_75636 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E20D M116T R137Q N289D % Freq CORP
1 E M R N 97.77 0.119
2 E T R N 1.08 0.352
3 E M R D 0.54 0.119
4 D M R N 0.31 0.119
5 E M Q N 0.31 0.119

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4S1.aApr07-unspliced main_exon CDS chr11 48,306,223 48,307,149 +
3UTR chr11 48,307,149 48,307,152 +