Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4S2 Olfactory Receptor

Gene Symbol OR4S21 (View this gene in GeneCards)
Family 4
Subfamily S
Pseudogene No
CORP pseudogene probability score 0.21 (functional)
Aliases OR11-137, HsOR11.11.19
External Ids HGNC: 15183   GeneBank: AB065516, AF399447, AF546546-AF546559, BK004390, NM_001004059   
Build #39 labels OR4S2
Chromosomal location 11:55,650,904-55,651,836 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4B1 62.25% 302
OR4P4 60.26% 307
OR4X2 60.73% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4S2 89% 311
Chimp CONTIG970.68-4302 99% 311
Mouse Or4s2 90% 311
Mouse Or4s2b 88% 311
Rat Or4s2 89% 311
Cow OR4S2P 80% 307
Cow OR4S2CP 82% 303

Expression evidences

Source Accession
mRNA AB463967
GNF Atlas2 gnf1h05454_at

Sequence information

Nucleotide sequence ATGGAAAAAATAAACAACGTAACTGAATTCATTTTCTGGGGTCTTTCTCAGAGCCCAGAG
ATTGAGAAAGTTTGTTTTGTGGTGTTTTCTTTCTTCTACATAATCATTCTTCTGGGAAAT
CTCCTCATCATGCTGACAGTTTGCCTGAGCAACCTGTTTAAGTCACCCATGTATTTCTTT
CTCAGCTTCTTGTCTTTTGTGGACATTTGTTACTCTTCAGTCACAGCTCCCAAGATGATT
GTTGACCTGTTAGCAAAGGACAAAACCATCTCCTATGTGGGGTGCATGTTGCAACTGTTT
GGAGTACATTTCTTTGGTTGCACTGAGATCTTCATCCTTACTGTAATGGCCTATGATCGT
TATGTGGCTATCTGTAAACCCCTACATTATATGACCATCATGAACCGGGAGACATGCAAT
AAAATGTTATTAGGGACGTGGGTAGGTGGGTTCTTACACTCCATTATCCAAGTGGCTCTG
GTAGTCCAACTACCCTTTTGTGGACCCAATGAGATAGATCACTACTTTTGTGATGTTCAC
CCTGTGTTGAAACTTGCCTGCACAGAAACATACATTGTTGGTGTTGTTGTGACAGCCAAC
AGTGGTACCATTGCTCTGGGGAGTTTTGTTATCTTGCTAATCTCCTACAGCATCATCCTA
GTTTCCCTGAGAAAGCAGTCAGCAGAAGGCAGGCGCAAAGCCCTCTCCACCTGTGGCTCC
CACATTGCCATGGTCGTTATCTTTTTCGGCCCCTGTACTTTTATGTACATGCGCCCTGAT
ACGACCTTTTCAGAGGATAAGATGGTGGCTGTATTTTACACCATTATCACTCCCATGTTA
AATCCTCTGATTTATACACTGAGAAATGCAGAAGTAAAGAATGCAATGAAGAAACTGTGG
GGCAGAAATGTTTTCTTGGAGGCTAAAGGGAAA
Conceptual translation MEKINNVTEFIFWGLSQSPEIEKVCFVVFSFFYIIILLGNLLIMLTVCLSNLFKSPMYFF
LSFLSFVDICYSSVTAPKMIVDLLAKDKTISYVGCMLQLFGVHFFGCTEIFILTVMAYDR
YVAICKPLHYMTIMNRETCNKMLLGTWVGGFLHSIIQVALVVQLPFCGPNEIDHYFCDVH
PVLKLACTETYIVGVVVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGS
HIAMVVIFFGPCTFMYMRPDTTFSEDKMVAVFYTIITPMLNPLIYTLRNAEVKNAMKKLW
GRNVFLEAKGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,418,593 55,418,593 NS A/T T/S rs17146960 (DbSNP)
11 55,418,693 55,418,693 NS C/T S/F rs11230541 (DbSNP)
11 55,418,677 55,418,677 NS C/T L/F rs6591569 (DbSNP)
11 55,418,963 55,418,963 NS G/T G/V rs7949664 (DbSNP)
11 55,651,487 55,651,487 NS T/G V/G 1000GP (CEU)
11 55,651,217 55,651,217 NS T/C F/S 1000GP (CEU, CHBJPT)
11 100 -100 NS T/A S/T 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T Y/Y 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,359,025 55,470,359 CopyNumber Variation_0419 (DGV), Variation_34977 (DGV)
11 55,339,702 55,638,112 CopyNumber Variation_2926 (DGV)
11 55,222,420 55,621,884 CopyNumber Variation_3852 (DGV)
11 55,382,681 55,548,038 CopyNumber Variation_4743 (DGV)
11 55,367,167 55,452,993 CopyNumber Variation_6923 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,377,006 55,620,699 CopyNumber Variation_9188 (DGV)
11 55,371,021 55,422,586 CopyNumber Variation_9662 (DGV), Variation_48831 (DGV)
11 55,360,213 55,447,427 CopyNumber Variation_9663 (DGV), Variation_48827 (DGV)
11 55,371,021 55,447,427 CopyNumber Variation_10359 (DGV), Variation_48834 (DGV), Variation_48835 (DGV)
11 55,364,237 55,431,910 Inversion Variation_29474 (DGV)
11 55,360,213 55,447,426 CopyNumber Variation_29606 (DGV)
11 55,371,020 55,460,788 CopyNumber Variation_29910 (DGV)
11 55,367,884 55,459,183 CopyNumber Variation_31823 (DGV)
11 55,362,651 55,460,561 CopyNumber Variation_34978 (DGV)
11 55,358,496 55,434,466 CopyNumber Variation_37484 (DGV)
11 55,374,032 55,453,009 CopyNumber Variation_38079 (DGV)
11 55,368,154 55,450,788 CopyNumber Variation_38972 (DGV)
11 55,365,425 55,431,552 CopyNumber Variation_41253 (DGV)
11 55,335,878 55,453,486 CopyNumber Variation_48051 (DGV)
11 55,381,588 55,474,194 CopyNumber Variation_48053 (DGV)
11 55,360,213 55,442,368 CopyNumber Variation_48826 (DGV)
11 55,360,213 55,470,003 CopyNumber Variation_48828 (DGV)
11 55,371,021 55,437,126 CopyNumber Variation_48832 (DGV)
11 55,371,021 55,442,368 CopyNumber Variation_48833 (DGV)
11 55,371,021 55,460,095 CopyNumber Variation_48836 (DGV)
11 55,383,157 55,447,427 CopyNumber Variation_48837 (DGV), Variation_53573 (DGV)
11 55,396,041 55,442,368 CopyNumber Variation_48839 (DGV)
11 55,339,829 55,447,427 CopyNumber Variation_53140 (DGV)
11 55,408,664 55,447,427 CopyNumber Variation_53178 (DGV)
11 55,360,213 55,490,377 CopyNumber Variation_53507 (DGV)
11 55,360,213 55,460,788 CopyNumber Variation_53994 (DGV)
11 55,360,213 55,470,994 CopyNumber Variation_54018 (DGV)
11 55,364,677 55,453,061 CopyNumber Variation_65955 (DGV)
11 55,366,131 55,452,023 CopyNumber Variation_75644 (DGV)
11 55,365,707 55,452,023 CopyNumber Variation_85779 (DGV)
Deletion 254 (Hasin)
11 55,418,280 55,421,312 Deletion #10 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S72T V81I F105S V195G L213Q R232C M296V % Freq CORP
1 S V F V L R M 72.12 0.409
2 S V S V L R M 18.43 0.409
3 S V F G L R M 3.38 0.409
4 T V S V L C M 2.53 0.409
5 S I F V L R M 1.38 0.409
6 S V S V L C M 0.84 0.409
7 S V F V L R V 0.38 0.409
8 S I F V Q R M 0.38 0.409
9 S V F V Q R M 0.23 0.409
10 S V F V L C M 0.23 0.409
11 S V F G L C M 0.08 0.409

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4S2.aApr07-unspliced main_exon CDS chr11 55,650,904 55,651,836 +
3UTR chr11 55,651,836 55,651,839 +