Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4X1 Olfactory Receptor

Gene Symbol OR4X11 (View this gene in GeneCards)
Family 4
Subfamily X
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR11-104, HsOR11.8.4, ORL3323
External Ids HGNC: 14854   GeneBank: AB065544, BK004388, NM_001004726   ORDB: ORL3323   
Build #39 labels OR4X1
Chromosomal location 11:48,263,861-48,264,775 (+)
Cluster 11@48
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs10838851 (AA change=Y/* )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4X2 63.01% 292

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4X5 76% 305
Chimp CONTIG1131.58-14064 98% 305
Mouse Or4x5-ps 78% 304
Rat Or4x5 78% 304
Cow OR4X5 78% 303

Expression evidences

Source Accession
GNF Atlas2 gnf1h02095_at

Sequence information

Nucleotide sequence ATGGTTGCTACAAACAATGTGACTGAAATAATTTTCGTGGGATTTTCCCAGAATTGGAGT
GAGCAGAGGGTCATTTCTGTGATGTTTCTCCTCATGTACACAGCTGTTGTGCTGGGCAAT
GGCCTCATTGTGGTGACCATCCTGGCCAGCAAAGTGCTCACCTCCCCCATGTATTTCTTT
CTCAGCTACTTATCCTTTGTGGAGATCTGCTACTGTTCTGTCATGGCCCCCAAGCTTATC
TTTGACTCCTTTATCAAGAGGAAAGTCATTTCTCTCAAGGGCTGCCTCACACAGATGTTT
TCCCTCCATTTCTTTGGTGGCACTGAGGCCTTTCTCCTGATGGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCTTGCACTACATGGCCATCATGAACCAGCGAATGTGTGGT
CTCCTCGTGAGGATAGCATGGGGCGGGGGCCTGCTGCATTCTGTTGGGCAAACCTTCCTG
ATTTTCCAGCTCCCGTTCTGTGGCCCCAACATCATGGACCACTACTTCTGTGATGTCCAC
CCAGTGCTGGAGCTGGCCTGCGCAGACACCTTCTTCATTAGCCTGCTGATCATCACCAAT
GGCGGCTCCATCTCCGTAGTCAGTTTCTTCGTGCTGATGGCTTCCTACCTGATCATCCTG
CACTTCCTGAGAAGCCACAACTTGGAGGGGCAGCACAAGGCCCTCTCCACCTGTGCCTCT
CATGTCACAGTTGTCGACCTGTTCTTCATACCTTGCTCCTTGGTCTATATTAGGCCCTGT
GTCACCCTCCCTGCAGACAAGATAGTTGCTGTATTTTATACAGTGGTCACACCTCTCTTA
AACCCTGTGATTTACTCCTTCAGGAATGCTGAAGTGAAAAATGCCATGAGGAGATTTATT
GGGGGAAAAGTAATT
Conceptual translation MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFF
LSYLSFVEICYCSVMAPKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDR
YVAICKPLHYMAIMNQRMCGLLVRIAWGGGLLHSVGQTFLIFQLPFCGPNIMDHYFCDVH
PVLELACADTFFISLLIITNGGSISVVSFFVLMASYLIILHFLRSHNLEGQHKALSTCAS
HVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVKNAMRRFI
GGKVI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 nonsense SNP T/A Y/* 1000GP (YRI)
11 100 -100 NS G/A A/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G T/T 1000GP (YRI, YRI)
11 48,264,218 48,264,218 NS C/T R/C 1000GP (CEU)
11 48,264,290 48,264,290 NS A/G R/G 1000GP (CEU, CHBJPT)
11 48,264,304 48,264,304 SYN C/T G/G 1000GP (CEU, CHBJPT)
11 48,264,354 48,264,354 NS C/T P/L 1000GP (CEU, CHBJPT)
11 48,264,653 48,264,653 NS G/C A/P 1000GP (CEU)
11 48,264,679 48,264,679 nonsense SNP T/A Y/* 1000GP (CEU, CHBJPT)
11 48,264,682 48,264,682 SYN A/G T/T 1000GP (CEU)
11 48,264,692 48,264,692 NS C/A P/T 1000GP (CEU)
11 48,264,704 48,264,704 NS C/T P/S 1000GP (CEU, CHBJPT)
11 48,285,424 48,285,424 SYN G/A T/T rs713323 (DbSNP)
11 48,285,740 48,285,740 NS A/G T/A rs61747640 (DbSNP)
11 48,285,842 48,285,842 NS G/A G/R rs1503193 (DbSNP)
11 48,285,856 48,285,856 SYN C/T G/G rs10838850 (DbSNP)
11 48,285,906 48,285,906 NS C/T P/L rs16905753 (DbSNP)
11 48,285,959 48,285,959 NS A/C M/L rs12796681 (DbSNP)
11 48,285,965 48,285,965 NS C/G L/V rs12796828 (DbSNP)
11 48,285,986 48,285,988 Del(3) -/TTC rs57294041 (DbSNP)
11 48,285,995 48,285,995 NS A/C M/L rs12796846 (DbSNP)
11 48,285,999 48,285,999 NS A/T Q/L rs12798361 (DbSNP)
11 48,286,043 48,286,043 NS A/G M/V rs61915300 (DbSNP)
11 48,286,086 48,286,086 NS A/G N/S rs61746892 (DbSNP)
11 48,286,148 48,286,148 NS A/G N/D rs17199104 (DbSNP)
11 48,286,231 48,286,231 nonsense SNP A/T */Y rs10838851 (DbSNP)
11 48,286,234 48,286,234 SYN A/G T/T rs61732322 (DbSNP)
11 48,286,256 48,286,256 NS C/T P/S rs10838852 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A49V A110T R120C V143M R144G P165L S225N D246N Y256C A265P Y273* P282S % Freq CORP
1 A A R V G P S D Y A * S 40.17 1.200
2 A A R V G P S D Y A Y P 32.87 0.093
3 A A R V G L S D Y A * P 15.82 1.200
4 A A R V G P S D Y A * P 4.07 1.200
5 A A R V G P N D Y A * S 3.38 1.200
6 A A R V R P S D Y A Y P 1.08 0.093
7 A A C V G P S D Y A Y P 0.77 0.645
8 A A R V G L S N Y A * P 0.46 1.200
9 A T R V G P S D Y A Y P 0.31 0.093
10 A A R V G L S D C A * P 0.23 1.200
11 A A R V G P S N Y A * S 0.23 1.200
12 V A R V G P S D Y A * S 0.23 1.200
13 A A R V G L S D Y A * S 0.15 1.200
14 A A R M G P S D Y A * S 0.15 1.200
15 A A R V G P S D Y P * S 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4X1.aApr07-unspliced main_exon CDS chr11 48,263,861 48,264,775 +
3UTR chr11 48,264,775 48,264,778 +