Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A10P Olfactory Receptor

Gene Symbol OR51A10P1 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-42, HsOR11.3.67P, ORL3567
External Ids HGNC: 15185   GeneBank: BK004683, NG_004229   ORDB: ORL3567   
Build #39 labels OR51A10P, OR51A11P, OR51A13
Chromosomal location 11:5,468,504-5,469,359 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51G2 52.8% 286
OR51I1 56.94% 281
OR51I2 59.93% 282

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A10 86% 288
Chimp CONTIG*********** 96% 286
Mouse Or51a10 85% 289
Rat Or51a10 86% 289
Cow OR51A10 85% 289

Expression evidences

Source Accession
ESTs BF132682
mRNA BC022184

Sequence information

Nucleotide sequence ATGAAGGGTCTGGAGCACTGGCTGGCTGCCCTTCTGCTGCTGCTTTGTGCTATTTCCTTC
CTGGGCAACATCCTCATCCTCTTTATCATAAAGGAAGAGCAGAGCTTGCACCAGCCAATG
TACTACTTCCTGTCTCTTTTTTCTGTTAATGACCTGGGTGTGTCCTTTTCTACATTGCCC
ACTGTACTGGCTGCTGTGTGTTTTCATGCCCCAGAGACAACTTTTGATGCCTGCCTGGCC
CAGACGTTCTTCATCCACTTTTCCTCCTGGACAGAGTTTGGCATCCTACTGGCCATGAGT
TTTGACCACTATGTGGCCATCTGTAACCCGCTGCGCTATGCCACAGTGCTCACTGATGTC
CGTGTGGCCCACAATGGCATATCCATTGTCATCCGCAGCTTCTGCATGGTATTCCCACTT
CCCTTCCTCCTGAAGAGACTGCCTTTCTGTAAGGCCAGTGTGGTACTGGCCCATTCCTAC
TGTCTGCATGCAGACCTGATTCGGCTGCCCTGTGGAGACACTACCATCAACAGCATGTAT
GGCCTGTTCATTGTCATCTCTGCCTTTGGTGTAGATTCACTGCTCATCCTCCTCTCCTAT
GTGCTCATTCTACATTCTGTGCTGGCCATTGCCTCCAGGGGTGAGAGGCTTAAGACACTC
AACACATGTGTGTCACATATCTATGCAGTGCTGATCTTCTATGTGCCTATGGTTAGTGTG
TCCATGGTTCATCGATTTGGGAGGCATGCTCCTGAATATGTGCACAAGTTCATGTCTCTT
TGTACCTCCAATGCTCTACCCAATTATCTATTCCATCAAGACTAAGGAGATTCGCAGGAG
ACTACACAAGATGTTA
Conceptual translation MKGLEHWLAALLLLLCAISFLGNILILFIIKEEQSLHQPMYYFLSLFSVNDLGVSFSTLP
TVLAAVCFHAPETTFDACLAQTFFIHFSSWTEFGILLAMSFDHYVAICNPLRYATVLTDV
RVAHNGISIVIRSFCMVFPLPFLLKRLPFCKASVVLAHSYCLHADLIRLPCGDTTINSMY
GLFIVISAFGVDSLLILLSYVLILHSVLAIASRGERLKTLNTCVSHIYAVLIFYVPMVSV
SMVHRFGRHAPEYVHKFM/S/VPPMLYPIIYSIKTKEIRRRLHKML

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 5,468,847 5,468,847 SNP A/C 1000GP (CEU, CHBJPT)
11 5,468,925 5,468,925 SNP C/G 1000GP (CEU, CHBJPT)
11 5,468,952 5,468,952 SNP C/T 1000GP (CEU, CHBJPT)
11 5,469,115 5,469,115 SNP G/A 1000GP (CEU, CHBJPT)
11 5,469,241 5,469,241 SNP A/G 1000GP (CEU)
11 5,469,249 5,469,249 SNP G/A 1000GP (CHBJPT)
11 5,469,299 5,469,299 SNP G/A 1000GP (CEU, CHBJPT)
11 5,469,313 5,469,313 SNP C/T 1000GP (CEU, CHBJPT)
11 5,489,927 5,489,927 SNP G/A rs61748001 (DbSNP)
11 5,489,965 5,489,965 Del(1) -/C rs35984509 (DbSNP)
11 5,490,077 5,490,077 SNP C/A rs2736569 (DbSNP)
11 5,490,118 5,490,118 Del(1) -/G rs35709721 (DbSNP)
11 5,490,155 5,490,155 SNP C/G rs7925620 (DbSNP)
11 5,490,159 5,490,159 SNP A/G rs7940178 (DbSNP)
11 5,490,182 5,490,182 SNP C/T rs17297010 (DbSNP)
11 5,490,345 5,490,345 SNP G/A rs449937 (DbSNP)
11 5,490,372 5,490,372 SNP T/G rs61738627 (DbSNP)
11 5,490,408 5,490,408 SNP A/G rs55679555 (DbSNP)
11 5,490,454 5,490,453 Ins(1) -/A rs58849486 (DbSNP)
11 5,490,471 5,490,471 SNP G/A rs61743063 (DbSNP)
11 5,490,472 5,490,472 SNP T/C rs61741554 (DbSNP)
11 5,490,529 5,490,529 SNP A/G rs10768978 (DbSNP)
11 5,490,543 5,490,543 SNP T/C rs366257 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,416,622 5,492,033 CopyNumber Variation_2901 (DGV)
11 5,431,984 5,493,309 CopyNumber Variation_9174 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.