Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A1P Olfactory Receptor

Gene Symbol OR51A1P1 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HPFH6OR, OR11-35, HsOR11.3.52P, ORL506
External Ids HGNC: 8316   GeneBank: AY284453-AY284484, BK004750, NG_002199   ORDB: ORL506   
Build #39 labels OR51A1P
Chromosomal location 11:5,170,354-5,171,223 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51G2 53.57% 280
OR51I2 50.72% 278
OR51K1P 57.34% 286

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A1 82% 289
Chimp CONTIG465.94-852 96% 290
Mouse Or51j3 68% 265
Rat Or51j3 67% 287
Cow OR51J3 63% 289

Sequence information

Nucleotide sequence ATGTGGATATCCATCCCCTTCTGCCTGATATACACCATCATCTTTCCGGGAAATGGCATC
ATTCTTCACATCATCCGAATTGACTCTTCCTTGCACCAACCCATGTACTATTTTCTGGCC
ATGCCGGCCTTTGTTGAACTTGGTGTCTCTGCTTCCACCATGCCCACTGTGTTAAGCATA
TTCCTCTTTGGCATTAACGATGTCAGTTTTGGTGGTTGCCTGCTCCAGATGTTTTCTATG
CACTCTTTCACTCTTATGGAGTCAGGTGTCCTTCTGGCAATGTCAGTGGACCGCTTTGTG
GCCATCTACAGCCCACTGCGCTACACAACCATTCTGACAATTGCCTGCATTTCTGGGACG
GGTGCCGCCATTGCCTTGCGCAGTGTAATGCTTATGCTCCCACTGCTCTTTCTCCTGAGG
CGTCTGCCTTTCTGTGGCCACAATACCCTCACACACTCTTATTGCCTCCACTCAGATCTG
ATCAAATTGCCCTGTGGAGACACACGTCCCAATAGCATCCTGGCTCTATTTGTCATTACC
TTCACATTTGGACTGGACTTATTGTTCATTGTGGTTTCTTATGTGCTGATTCTTCATACA
GTACTGGAAATAGCTTCTGGAGCAGGGCGGTGGCAGGCACTCAACACATGTGTGTCGCAC
ATATGTGCTGTGCTTGTGTACTATGTGCCCATGATCAGCCTCTCCCTGATGCACCGCTTT
GGACGGCATTTACCTCCACTTTTCCAGACTGTCACGGCCAATGCTTACCTCTTTTTTCCT
CCTGTGGTCAACCCCATTGTCTATAGTATCAAAATCAAAGAAATTCGCAACAGCGTTGTT
CTTACACTATCCAGGAAGAGGGGTGAGTTC
Conceptual translation MWISIPFCLIYTIIFPGNGIILHIIRIDSSLHQPMYYFLAMPAFVELGVSASTMPTVLSI
FLFGINDVSFGGCLLQMFSMHSFTLMESGVLLAMSVDRFVAIYSPLRY\PFXLPAFLG
RV/AIALRSVMLMLPLLFLLRRLPFCGHNTLTHSYCLHSDLIKLPCGDTRPNSILALFV
ITFTFGLDLLFIVVSYVLILHTVLEIASGAGRWQALNTCVSHICAVLVYYVPMISLSLMH
RFGRHLPPLFQTVTANAYLFFPPVVNPIVYSIKIKEIRNSVVLTLSRKRGEF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,191,680 5,191,680 SNP A/G rs10160707 (DbSNP)
11 5,191,947 5,191,947 SNP A/G rs7478693 (DbSNP)
11 5,192,095 5,192,095 SNP A/G rs7481262 (DbSNP)
11 5,192,015 5,192,015 SNP C/G rs73396897 (DbSNP)
11 5,192,074 5,192,074 SNP C/T rs73396898 (DbSNP)
11 5,170,450 5,170,450 SNP A/G 1000GP (CEU, CHBJPT)
11 5,170,642 5,170,642 SNP A/G 1000GP (CEU)
11 5,170,717 5,170,717 SNP A/G 1000GP (CEU, CHBJPT)
11 5,170,865 5,170,865 SNP G/A 1000GP (CEU, CHBJPT)
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.