Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A3P Olfactory Receptor

Gene Symbol OR51A3P1 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-30, HsOR11.3.36P, ORL3497
External Ids HGNC: 14794   GeneBank: BK004774, NG_002268   ORDB: ORL3497   
Build #39 labels OR51A3P
Chromosomal location 11:4,937,356-4,938,294 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A2 57.61% 309
OR51A4 59.16% 311
OR51A7 60.39% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A8 60% 311
Chimp CONTIG465.120-12215 96% 313
Mouse Or51a6 61% 308
Rat Or51a45-ps 64% 294
Cow OR51A52 80% 313

Sequence information

Nucleotide sequence ATGTCTCCTCTTAATGACACAAAAATGGAAGTCCTTAGATTCCTCCTTATCGGGATCACT
GGACTGGAGAAAAGTCGCACCTGGATATCCATTCCTTTCTTATCTGTGTACCTTCTTTCT
TGGATGGGTAATTTTACCGTCCTCTTTTTTATCAAGACAGAGCAAAGCCTCCATGAACCT
ATGTATTATTTGCTTTCCATGCTCTCCATCTCTGACCTAGGGCTGTCTCTGTCTTCCTTA
CCCATCACTTTGGGACTATTCCTATTTGATGTCCATGAAATTCATGCAGCTCCATGCTTT
GCCTAGGAATTTTTTATCCATCTGTTTACAGTCAGTGAAGCCTCTGTACTGTCTGTAATG
GCATTTGACTGGTATGTGGCAATCCACAGTCCTTTGAGATACAGCACTATCTTAACTAGT
CCCAGAGCCATCAAAACAGGGGTTCTTCTGACTTCCAAGAATGTTCTTTTGATCCTTCCA
CTGCCCTTTCTCTTGCAAAGGCTGAGATATTGTCATCAAAACCTGCTCTCCCACTCCTAT
TGTCTCCACCAGGATGTCATGAAGCTGATGTGTTCTGACAACACAGTCAATGTTGTCTAC
GGACTCTGTGCAGGACTTTCTACTATGCTGGACTTGGTGTTTATTACCTTCTCCTAAATT
ATGATTTTAAGGGCTGTACTGGGAATTGCTACCCCCAGACAGCAGTTCAAGGCCCTCAAC
ACGTGCATCTCTCACATCTGTGCTGTGCTTATCTTCTATGTGCCCACGCTGAGTGCTGCC
ATGCTCCACCAGTTTGCCAGGGATGTGTCTCCTATGATCCACGTCCTCATGGCTGATATT
TTTCTGCTGGTGCCACCCCTGTTGAATCCCATCGTGTACTGTGTGAAGACCCACCAAATC
CGAGAAAAGGTTGTGGGGAAACTTTGTCCAAAAGTAAGT
Conceptual translation MSPLNDTKMEVLRFLLIGITGLEKSRTWISIPFLSVYLLSWMGNFTVLFFIKTEQSLHEP
MYYLLSMLSISDLGLSLSSLPITLGLFLFDVHEIHAAPCFAXFFIHLFTVSEASVLSVM
AFDWYVAIHSPLRYSTILTSPRAIKTGVLLTSKNVLLILPLPFLLQRLRYCHQNLLSHSY
CLHQDVMKLMCSDNTVNVVYGLCAGLSTMLDLVFITFSXMILRAVLGIATPRQQFKALN
TCISHICAVLIFYVPTLSAAMLHQFARDVSPMIHVLMADIFLLVPPLLNPIVYCVKTHQI
REKVVGKLCPKVS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 4,937,417 4,937,417 SNP T/C 1000GP (CEU, CHBJPT)
11 4,937,472 4,937,472 SNP C/T 1000GP (CEU)
11 4,937,528 4,937,528 SNP G/A 1000GP (CEU, CHBJPT)
11 4,937,731 4,937,731 SNP C/T 1000GP (CEU, CHBJPT)
11 4,937,850 4,937,850 SNP G/A 1000GP (CEU)
11 4,937,925 4,937,925 SNP A/G 1000GP (CEU)
11 4,938,050 4,938,050 SNP A/G 1000GP (CEU)
11 4,938,249 4,938,249 SNP G/A 1000GP (CEU, CHBJPT)
11 4,958,647 4,958,647 SNP C/T rs11034732 (DbSNP)
11 4,958,702 4,958,702 SNP C/T rs16907558 (DbSNP)
11 4,958,758 4,958,758 SNP G/A rs2596005 (DbSNP)
11 4,958,833 4,958,833 Del(1) -/G rs34522077 (DbSNP)
11 4,958,961 4,958,961 SNP C/T rs17339000 (DbSNP)
11 4,959,265 4,959,264 Ins(1) -/G rs34311978 (DbSNP)
11 4,959,479 4,959,479 SNP A/G rs72858189 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 92 (Hasin)
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 4,946,334 4,979,373 CopyNumber Variation_34970 (DGV)
11 4,950,959 4,997,769 CopyNumber Variation_34971 (DGV)
11 4,952,232 4,977,682 CopyNumber Variation_34973 (DGV)
11 4,959,236 4,985,373 CopyNumber Variation_0413 (DGV), Variation_34974 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.