Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A4 Olfactory Receptor

Gene Symbol OR51A41 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene No
CORP pseudogene probability score
Aliases HsOR11.3.37, ORL3444
External Ids HGNC: 14795   GeneBank: AB065798, NM_001005329   ORDB: ORL3444   
Build #39 labels OR51A4
Chromosomal location 11:4,946,162-4,947,100 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A2 96.81% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A8 74% 308
Mouse Or51a6 75% 308
Rat Or51a7b 73% 308
Cow OR51A4P 86% 313
Cow OR51A4B 84% 313
Orang OR51A4DP 97% 228
Horse OR51A5 71% 312
Chimp OR51A5 72% 312

Expression evidences

Source Accession
mRNA BC140757

Sequence information

Nucleotide sequence ATGTCCATTATCAACACATCATATGTTGAAATCACCACCTTCTTCTTGGTTGGGATGCCA
GGGCTAGAATATGCACACATCTGGATCTCTATCCCCATCTGCAGCATGTATCTTATTGCT
ATTCTAGGAAATGGCACCATTCTTTTTATCATCAAGACAGAGCCCTCCTTGCATGAGCCC
ATGTACTATTTTCTTTCCATGTTGGCTATGTCAGACTTGGGTTTGTCTTTATCATCTCTG
CCCACTGTGTTAAGCATCTTCCTGTTCAATGCTCCTGAAATTTCATCCAATGCCTGCTTT
GCCCAGGAATTCTTCATTCATGGATTCTCAGTACTGGAGTCCTCAGTCCTCCTGATCATG
TCATTTGATAGATTCCTAGCCATCCACAACCCTCTGAGATACACCTCAATCCTGACAACT
GTCAGAGTTGCCCAAATAGGGATAGTATTCTCCTTTAAGAGCATGCTCCTGGTTCTTCCC
TTCCCTTTCACTTTAAGAAACTTGAGATATTGCAAGAAAAACCAATTATCCCATTCCTAC
TGTCTCCACCAGGATGTCATGAAGTTGGCCTGTTCTGACAACAGAATTGATGTTATCTAT
GGCTTTTTTGGAGCACTCTGCCTTATGGTAGACTTTATTCTCATTGCTGTGTCTTACACC
CTGATCCTCAAGACTGTACTGGGAATTGCATCCAAAAAGGAGCAGCTTAAGGCTCTCAAT
ACTTGTGTTTCACACATCTGTGCAGTGATCATCTTCTACCTGCCCATCATCAACCTGGCC
GTTGTCCACCGCTTTGCCCGGCATGTCTCTCCCCTCATTAATGTTCTCATGGCAAATGTT
CTCCTACTTGTACCTCCACTGACGAACCCAATTGTTTATTGTGTAAAAACTAAACAGATT
AGAGTGAGAGTTGTAGCAAAATTGTGTCAACGGAAGATT
Conceptual translation MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHEP
MYYFLSMLAMSDLGLSLSSLPTVLSIFLFNAPEISSNACFAQEFFIHGFSVLESSVLLIM
SFDRFLAIHNPLRYTSILTTVRVAQIGIVFSFKSMLLVLPFPFTLRNLRYCKKNQLSHSY
CLHQDVMKLACSDNRIDVIYGFFGALCLMVDFILIAVSYTLILKTVLGIASKKEQLKALN
TCVSHICAVIIFYLPIINLAVVHRFARHVSPLINVLMANVLLLVPPLTNPIVYCVKTKQI
RVRVVAKLCQRKI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A T/M 1000GP (YRI, YRI)
11 100 -100 SYN C/T L/L 1000GP (YRI)
11 4,946,238 4,946,238 NS G/A T/M 1000GP (CEU, CHBJPT)
11 4,946,302 4,946,302 NS G/C R/G 1000GP (CEU)
11 4,946,421 4,946,421 NS A/G L/P 1000GP (CEU)
11 4,946,601 4,946,601 NS T/C N/S 1000GP (CEU)
11 4,967,400 4,967,400 NS G/A R/W rs2436782 (DbSNP)
11 4,967,464 4,967,464 NS G/T N/K rs73388946 (DbSNP)
11 4,967,468 4,967,468 NS A/G M/T rs28698374 (DbSNP)
11 4,967,473 4,967,473 SYN C/T P/P rs72639631 (DbSNP)
11 4,967,532 4,967,532 NS C/G G/R rs2595988 (DbSNP)
11 4,967,678 4,967,678 NS A/G F/S rs12271991 (DbSNP)
11 4,967,831 4,967,831 NS T/C N/S rs2595987 (DbSNP)
11 4,967,941 4,967,941 SYN A/G N/N rs72860814 (DbSNP)
11 4,968,117 4,968,117 NS T/C N/D rs2412467 (DbSNP)
11 4,968,131 4,968,131 NS G/A T/M rs2412466 (DbSNP)
11 4,968,198 4,968,198 NS C/A G/C rs3845246 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 4,946,334 4,979,373 CopyNumber Variation_34970 (DGV)
11 4,950,959 4,997,769 CopyNumber Variation_34971 (DGV)
11 4,952,232 4,977,682 CopyNumber Variation_34973 (DGV)
11 4,959,236 4,985,373 CopyNumber Variation_0413 (DGV), Variation_34974 (DGV)
11 4,961,913 4,992,282 CopyNumber Variation_2900 (DGV)
11 4,966,798 4,976,975 CopyNumber Variation_23184 (DGV)
11 4,966,925 4,977,889 CopyNumber Variation_65847 (DGV)
11 4,967,091 4,976,651 CopyNumber Variation_101113 (DGV)
11 4,967,343 4,976,055 CopyNumber Variation_85627 (DGV)
11 4,967,343 4,977,111 CopyNumber Variation_75525 (DGV)
11 4,967,343 4,980,015 CopyNumber Variation_75523 (DGV), Variation_85626 (DGV)
11 4,967,783 4,993,968 CopyNumber Variation_34975 (DGV)
11 4,967,806 4,977,042 CopyNumber Variation_58515 (DGV)
11 4,967,827 4,976,675 CopyNumber Variation_30538 (DGV)
11 4,967,827 4,978,643 CopyNumber Variation_31803 (DGV)
11 4,968,108 4,977,116 CopyNumber Variation_22813 (DGV)
11 4,968,113 4,977,082 CopyNumber Variation_38836 (DGV)
11 4,968,156 4,976,768 CopyNumber Variation_41249 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T288M L227P S218F % Freq CORP
1 M L S 70.58 0.038
2 T L S 14.21 0.038
3 M P S 6.68 0.038
4 M L F 6.30 0.105
5 M P F 2.23 0.105

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51A4.aApr07-unspliced main_exon 3UTR chr11 4,946,159 4,946,162 -
CDS chr11 4,946,162 4,947,100 -