Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A5P Olfactory Receptor

Gene Symbol OR51A5P1 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.39P, ORL3502
External Ids HGNC: 14801   GeneBank: NG_002263   ORDB: ORL3502   
Build #39 labels OR51A5P
Chromosomal location 11:4,972,946-4,973,884 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A2 71.61% 310
OR51A4 72.12% 312
OR51A7 72.73% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A8 76% 312
Chimp CONTIG465.114-14732 98% 313
Mouse Or51a5 83% 313
Rat Or51a5b-ps 75% 313
Cow OR51A5C 86% 313
Cow OR51A5 86% 313

Sequence information

Nucleotide sequence ATGTCCATTCTCAATACCTCTGAAATGGAAATCTCTATTTTCTACTTGGTTGGGATCCCA
GGTTTGGAGCATGCCAATATTTGGATCTCTATCCCCATATGTCTCATGTACACTGTTGCT
ATCCTAGGGAATTGTACCATTCTGTTTTTCATAAAAACAGAGCCTTCTTTGCATGAGCCC
ATGTACTATTTTCTCTCCATGTTGGCTCTCTCTGACCTGGGACTATCCCTCTCCTCTCTC
CCTACCATGTTAAGGATTTTCCTGTTCAATGCTCCAGGAATTTCCCCTGATGCCTGTATT
GCTCAAGAGTTTTTCATCCATGGATTCTCAGCTATGGAGTCATCTGTACTTCTTATAATG
TCCTTTGATCGCTTTATTGCCATCTGCAACCCCCTGAGATACACTTCCATCCTCACCAGT
GCCAGAGTCATTCAAATTGGGCTTGCTTTTTCTCTCAAAAATGTTTTGTTGATCCTCCCA
TTTCCTTTCACTCTAAAACATCTAAAATATTGTAAGAAGAACCTCCTGTCCCAATCCTAC
TGCCTCCATCAAGATGTCATGAAACTGGCCTGCACTGACAACAAGGTCAACATCATCTAT
GGCTTATTTGTGGCTCTCACAGGCATCCTAGACTTGACATTTATTTTCATGTCCTACATG
TTGATACTGAAAGCAGTGTTGAGCATAGCATCATGAAAGAAAAGGCTCAAGGTCCTCAAT
ACATGTGTTTCCCACATCTGTGCTGTGCTCATCTTCTATGTGCCCATTATCTCCCTAGCT
GTCATCTACCGGTTTGCCAAACACAGTTTCCCAATCACTAGGATCCTCATAGCTGATGCT
TTTCTGCTGGTGCCTCCATTGATGAACCCCATTGTATACTGTGTGAAGAGCCAGCAGATA
AGAAATCTTGTCTTAGAAAAACTGTGCCAGAAGCAAAGC
Conceptual translation MSILNTSEMEISIFYLVGIPGLEHANIWISIPICLMYTVAILGNCTILFFIKTEPSLHEP
MYYFLSMLALSDLGLSLSSLPTMLRIFLFNAPGISPDACIAQEFFIHGFSAMESSVLLIM
SFDRFIAICNPLRYTSILTSARVIQIGLAFSLKNVLLILPFPFTLKHLKYCKKNLLSQSY
CLHQDVMKLACTDNKVNIIYGLFVALTGILDLTFIFMSYMLILKAVLSIASXKRLKVLN
TCVSHICAVLIFYVPIISLAVIYRFAKHSFPITRILIADAFLLVPPLMNPIVYCVKSQQI
RNLVLEKLCQKQS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI)
11 4,973,289 4,973,289 SNP A/G 1000GP (CHBJPT)
11 4,973,683 4,973,683 SNP A/G 1000GP (CHBJPT)
11 4,994,677 4,994,676 Ins(1) -/C rs35367467 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 4,950,959 4,997,769 CopyNumber Variation_34971 (DGV)
11 4,994,293 4,998,017 CopyNumber Variation_85628 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.