Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A6P Olfactory Receptor

Gene Symbol OR51A6P1 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-17, HsOR11.3.32P, ORL3535
External Ids HGNC: 15187   GeneBank: AY284485-AY284516, BK004772, NG_004325   ORDB: ORL3535   
Build #39 labels OR51A6P
Chromosomal location 11:4,889,578-4,890,596 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A5P 64.5% 338
OR51A7 68.86% 334
OR51A8P 66.18% 340

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A6 80% 337
Chimp CONTIG465.125-13872 97% 341
Mouse Or51a6 81% 337
Rat Or51a6-ps 74% 332
Cow OR51A6P 74% 333

Sequence information

Nucleotide sequence ATGCACCTTCCCAATTCTTCTGAAATTGCGATTACCACCTTCTTTCTGATTGGAATACCA
GGGCTGGAGCATGCCCATATATGGATATCTGTCCCCATCTGCCTCATGTACTTGGTAGCC
ATCCTAGGCAATTGCACAATCCTCTTTGTTATCAGGACTGAGCCCTCACTCCATGCACCC
ATGTACTATTTCCTTTCCATGTTGGCTGTCTCTGATCTGGGCCTGTCCCTCTCCTACCTA
CCCACTATGCTGAGGATCTTTGTATTCAATGCCACAGGAATCTCCTCAAATGCTCGCTTT
GCTCAAGAATTCTTTATTCATGGATTCACAGATATGGAGTCCTCAGTGCTTCTCGTCATG
TCTTTTGACCGGTTTTGGCCATATGCCACCCTCTGAGGTACATATCTGAGGTACTGGTGA
GCTGTATCCTCACCAGTGCCAGAGTTGCCAAAATGGGGCTGTTGTTTCTCATTAAAAGAG
AAACAACACTAAACTCATTAAAAGAAACAACTAACTCATGCTGTTAGTACTCCCATTTCC
TTTCACTCTTACAAGGTTGACATATTGTAGGAAAAGCCTACTCTCTCATTCCTATTGTCT
CCATCAGGATGTCAGGAAGCTGGCCTGCTCCGACAACACTGTCAACTTCTTCTATGGTTT
CTTTCTTGCCCTCTGTATGATGTCAGAAAGTGTGTTCATTACTGTGTCTTATGTGCTCAT
CCTGAAGACGATCATGGGAATTGGATCCCATAGGGAGCGGCTCAAGGCCCTCAACACCTG
TGTCTCCCATATCTGTGCTGTGCTTATCTTCTATGCGCCCGTCATTGCTTTGGCATCCAT
GCACTGCTTTGGCATCCATGAACTGCTTTGGCAAGCACAGGTCCCCACTGGCCATGATCC
TCATTGCTGATGTTTTCTTGCTAGTGCCACCTCTTATGAATCCCATTGTATATTGTGTGA
AGACACAGCAAATTCATGAAAAAGTTTTAGGAAAACTGGGTCTACAACAACGGTGTCAG
Conceptual translation MHLPNSSEIAITTFFLIGIPGLEHAHIWISVPICLMYLVAILGNCTILFVIRTEPSLHAP
MYYFLSMLAVSDLGLSLSYLPTMLRIFVFNATGISSNARFAQEFFIHGFTDMESSVLLVM
SFDR/LAICHPLRYISEVLVSCILTSARVAKMGLLFLIKRETTLNSL/RNNXMLLVL
PFPFTLTRLTYCRKSLLSHSYCLHQDVRKLACSDNTVNFFYGFFLALCMMSESVFITVSY
VLILKTIMGIGSHRERLKALNTCVSHICAVLIFYAPVIALASMHCFG//MNCFGKHRS
PLAMILIADVFLLVPPLMNPIVYCVKTQQIHEKVLGKLGLQQRCQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 4,889,673 4,889,673 SNP C/T 1000GP (CEU)
11 4,889,709 4,889,709 SNP G/A 1000GP (CHBJPT)
11 4,890,064 4,890,064 SNP G/A 1000GP (CEU)
11 4,890,544 4,890,544 SNP C/G 1000GP (CEU)
11 4,910,903 4,910,903 SNP C/T rs35678658 (DbSNP)
11 4,911,238 4,911,238 Del(1) -/A rs35636691 (DbSNP)
11 4,911,564 4,911,564 SNP A/G rs73405021 (DbSNP)
11 4,911,774 4,911,774 SNP C/G rs17330155 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 4,908,808 4,911,926 CopyNumber #56 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.