Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A7 Olfactory Receptor

Gene Symbol OR51A71 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.21 (functional)
Aliases OR11-27, HsOR11.3.33, ORL3300
External Ids HGNC: 15188   GeneBank: AB065525, BK004284, NM_001004749   ORDB: ORL3300   
Build #39 labels OR51A7
Chromosomal location 11:4,907,370-4,908,305 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A2 70.45% 308
OR51A4 71.75% 308
OR51A5P 72.73% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A7 88% 312
Chimp CONTIG465.124-13719 98% 312
Mouse Or51a7 86% 312
Rat Or51a7b 86% 312
Rat Or51a7 86% 308
Cow OR51A7 87% 312
Cow OR51A7CP 84% 312

Expression evidences

Source Accession
mRNA BC137063
GNF Atlas2 gnf1h10687_at

Sequence information

Nucleotide sequence ATGTCTGTTCTCAATAACTCCGAAGTCAAGCTTTTCCTTCTGATTGGGATCCCAGGACTG
GAACATGCCCACATTTGGTTCTCCATCCCCATTTGCCTCATGTACCTGCTTGCCATCATG
GGCAACTGCACCATTCTCTTTATTATAAAGACAGAGCCCTCGCTTCATGAGCCCATGTAT
TATTTCCTTGCCATGTTGGCTGTCTCTGACATGGGCCTGTCCCTCTCCTCCCTTCCTACC
ATGTTGAGGGTCTTCTTGTTCAATGCCATGGGAATTTCACCTAATGCCTGCTTTGCTCAA
GAATTCTTCATTCATGGATTCACTGTCATGGAATCCTCAGTACTTCTAATTATGTCTTTG
GACCGCTTTCTTGCCATTCACAATCCCTTAAGATACAGTTCTATCCTCACTAGCAACAGG
GTTGCTAAAATGGGACTTATTTTAGCCATTAGGAGCATTCTCTTAGTGATTCCATTTCCC
TTCACCTTAAGGAGATTAAAATATTGTCAAAAGAATCTTCTTTCTCACTCATACTGTCTT
CATCAGGATACCATGAAGCTGGCCTGCTCTGACAACAAGACCAATGTCATCTATGGCTTC
TTCATTGCTCTCTGTACTATGCTGGACTTGGCACTGATTGTTTTGTCTTATGTGCTGATC
TTGAAGACTATACTCAGCATTGCATCTTTGGCAGAGAGGCTTAAGGCCCTAAATACCTGT
GTCTCCCACATCTGTGCTGTGCTCACCTTCTATGTGCCCATCATCACCCTGGCTGCCATG
CATCACTTTGCCAAGCACAAAAGCCCTCTTGTTGTGATCCTTATTGCAGATATGTTCTTG
TTGGTGCCGCCCCTTATGAACCCCATTGTGTACTGTGTAAAGACTCGACAAATCTGGGAG
AAGATCTTGGGGAAGTTGCTTAATGTATGTGGGAGA
Conceptual translation MSVLNNSEVKLFLLIGIPGLEHAHIWFSIPICLMYLLAIMGNCTILFIIKTEPSLHEPMY
YFLAMLAVSDMGLSLSSLPTMLRVFLFNAMGISPNACFAQEFFIHGFTVMESSVLLIMSL
DRFLAIHNPLRYSSILTSNRVAKMGLILAIRSILLVIPFPFTLRRLKYCQKNLLSHSYCL
HQDTMKLACSDNKTNVIYGFFIALCTMLDLALIVLSYVLILKTILSIASLAERLKALNTC
VSHICAVLTFYVPIITLAAMHHFAKHKSPLVVILIADMFLLVPPLMNPIVYCVKTRQIWE
KILGKLLNVCGR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A E/K 1000GP (YRI, YRI, YRI)
11 100 -100 SYN C/A T/T 1000GP (YRI, YRI, YRI, YRI)
11 4,907,391 4,907,391 NS G/A E/K 1000GP (CEU, CHBJPT)
11 4,907,611 4,907,611 NS T/C M/T 1000GP (CEU, CHBJPT)
11 4,907,636 4,907,636 SYN C/T A/A 1000GP (CEU, CHBJPT)
11 4,907,831 4,907,831 SYN C/G L/L 1000GP (CEU, CHBJPT)
11 4,907,866 4,907,866 nonsense SNP T/G L/* 1000GP (CEU)
11 4,928,621 4,928,621 NS A/G K/E rs11034596 (DbSNP)
11 4,928,787 4,928,786 Ins(1) -/C rs35302315 (DbSNP)
11 4,928,841 4,928,841 NS C/T T/M rs7108225 (DbSNP)
11 4,928,866 4,928,866 SYN C/T A/A rs7941509 (DbSNP)
11 4,929,061 4,929,061 SYN C/G L/L rs10500627 (DbSNP)
11 4,929,186 4,929,186 NS C/T A/V rs7108654 (DbSNP)
11 4,929,448 4,929,448 SYN A/G P/P rs7119629 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 91 (Hasin)
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 4,928,500 4,931,535 CopyNumber #120 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E8K M81T V196A % Freq CORP
1 E M V 70.97 0.118
2 K M V 21.74 0.118
3 E T V 5.99 0.118
4 E M A 1.31 0.118

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51A7.aApr07-unspliced main_exon CDS chr11 4,907,370 4,908,305 +
3UTR chr11 4,908,305 4,908,308 +