Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A8P Olfactory Receptor

Gene Symbol OR51A8P1 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-19, HsOR11.3.26P, ORL3542
External Ids HGNC: 15189   GeneBank: BK004775, NG_004387   ORDB: ORL3542   
Build #39 labels OR51A8P
Chromosomal location 11:4,832,133-4,833,069 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A5P 72.44% 312
OR51A7 72.17% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A8 86% 314
Chimp CONTIG465.130-15250 95% 314
Mouse Or51a8 85% 312
Rat Or51a7 73% 300
Cow OR51A8 82% 317

Sequence information

Nucleotide sequence ATGTTTCTGCTCAATACCTCAGAAGTTGAAGTCTCCACATTCCTATTGATTGGGATACCA
GGACTTGAGCATGCACACATTTGGATCTCTATCCCCATCTGCCTTATGTACCTCATGGCC
ATCCTGGGCAACTGCACCATCCTATTTGTTATCAGAACAGAGCATTCCCTGCAAGAGCCC
ATGTACTATTTCCTCTCCATGCTGGCCCTGTCCGACCTGGGCCTGTCTTTCTCCTCCCTA
CCCACGATGCTGAGAATCTTCTTGTTCAACAACATGGGGATTTCTGCTGATACATGCATT
GCCCAGGAATTCTTCATCCATGGATTCACAGACATGGAGTCTTCAGTTCTCCTAATCATG
TCCTTTGATCACTTAGTAGCCATTTGCAACCCCCTAAGATATAGCTCTATTCTCACCAGC
TTCAGGGTTTTGCAAATTGGACTGGCTTTTGCCATTAAAAGCATTCTCCTAGTGCTACCC
CTTTTACTTTAAAGAGACTCAGATACTGTAATAAACACCTTTTATCCCACTCCTACTGCC
TTCACCAGGATGTAATGAAGCTGGCCTGCTCTGACAACAGGGTTAACTTTTACTATGGTT
TGTTCGTTGCACTCTGCATGATGTCAGACAGTGTTTTTATTGCTATTTCCTATATGTGTT
CATCCTGAAGACTGTGTTGGGTATTGCATCCCATGGGGAGTGCCTCGAAGCTCTTGACAC
CTGTGTGTCTCATATCTGTGCTGTACTCGTCTTCTATGTGCCCATCATCACCTTGGCTAC
CATGCGTCGCTTTGCTAAGCATAAATCCCCTTTAGCTATGATTCTGATAGCAGATGCATT
CTTGCTGGTACCACCCTTGATGAATCCCATTGTGTATTGTGTAAAAACTCGGCAGATTAG
AGTAAAGGTCCTGGAAAAATTGGCTCTGAAGCCTAAA
Conceptual translation MFLLNTSEVEVSTFLLIGIPGLEHAHIWISIPICLMYLMAILGNCTILFVIRTEHSLQEP
MYYFLSMLALSDLGLSFSSLPTMLRIFLFNNMGISADTCIAQEFFIHGFTDMESSVLLIM
SFDHLVAICNPLRYSSILTSFRVLQIGLAFAIKSILLV/TPFTLKRLRYCNKHLLSHSY
CLHQDVMKLACSDNRVNFYYGLFVALCMMSDSVFIAISYMCSSXLCWVL/SHGECLEA
LDTCVSHICAVLVFYVPIITLATMRRFAKHKSPLAMILIADAFLLVPPLMNPIVYCVKTR
QIRVKVLEKLALKPK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 4,832,917 4,832,917 SNP C/T 1000GP (CEU)
11 4,854,147 4,854,147 SNP C/T rs17250199 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 222 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.