Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51A9P Olfactory Receptor

Gene Symbol OR51A9P1 (View this gene in GeneCards)
Family 51
Subfamily A
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-9, HsOR11.3.15P, ORL3549
External Ids HGNC: 15190   GeneBank: BK004782, NG_004320   ORDB: ORL3549   
Build #39 labels OR51A9P
Chromosomal location 11:4,660,832-4,661,730 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51G1 48.81% 293
OR51G2 51.56% 289
OR51I2 52.38% 294

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51A21 78% 301
Chimp CONTIG465.145-28512 94% 300
Mouse Or51a39 74% 295
Rat Or51a25 73% 300
Cow OR51A49 76% 301

Sequence information

Nucleotide sequence ATGATTGGCATCCCAGGGCTGGAGGCGGTTCATGGCTGGCTCGCCATCCCCTTCTCCTCC
ATGTACACTGTGGCCCTCCCTGGGAACTGCCTGATCCTCCTGGCTGTGAAGAGGAACCCC
AGCCTGCACCAGCCCATGTGCTACTTCCTGTCCATGCTGGCGCTCCCCAAAGCGGGCCTC
ACCTTGTCCACACTGCCCATCACCTTGGCTGTGCTCTGGTTTGACCACCGGCTCATGGGC
TTCAATGCCTGCCTGGTCCAGATGTTCTTCCTGCACTCCTCTGTGGTGGAGTCCTCAGTG
CTCCTGGCCATATCCTTTGACCACTTTGTGGCCATCTCCAACCCCCTGCACTATGCAGCT
GTCCTCACAAATAGTGTCATCATCAGGATTGGGCTGGCCATTGTGGCTCAAGTTACCTTG
TGCCTCTTCCTGTGCCATTTCCGGTTAAGAGTCTAAATTTCTGCCCTGGTGATAACATCC
CATCCCACTCGTTCTGTTTCCACCCTGATGTAATGAGGCGGGCCTGTGCGGACATCACGA
TCAATATATGCTATGGGGTCTACGTGGTTGTTTCTACAGGGGGCTTAGACTCGCTGCTCA
TCTTTCTGTCCTATACCTTCATCCTGCACACAGTCATGGGTCTGGCTGCTCCCAGGGAGC
GCATCTGGGCCCTCAACACCTGCGTTTCCCACATTCCGGCTGTCTTTGTCTTCTTTATTC
CAGGTATCACCGTGTCCATGATCCACCATTTTGGGAGGCACCTGCCCCACATTGTACATG
CTCTTGTTACCTATGTGTACCTGGTGATGCCTTCTGTGCTCCACCCCATCATTTACAGTA
TGAAGTCCAAGCCCATCAGGGAGGCCATCCTCAGGATGCTGATGGGGAGAAGCCAAGGC
Conceptual translation MIGIPGLEAVHGWLAIPFSSMYTVALPGNCLILLAVKRNPSLHQPMCYFLSMLALPKAGL
TLSTLPITLAVLWFDHRLMGFNACLVQMFFLHSSVVESSVLLAISFDHFVAISNPLHYAA
VLTNSVIIRIGLA/WGSSYLVPLPVPFPVKSLNFCPGDNIPSHSFCFHPDVMRRACADI
TINICYGVYVVVSTGGLDSLLIFLSYTFILHTVMGLAAPRERIWALNTCVSHIPAVFVFF
IPGITVSMIHHFGRHLPHIVHALVTYVYLVMPSVLHPIIYSMKSKPIREAILRMLMGRSQ
G

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 4,660,871 4,660,871 SNP C/T 1000GP (CEU, CHBJPT)
11 4,660,951 4,660,951 SNP C/A 1000GP (CEU)
11 4,661,034 4,661,034 SNP G/A 1000GP (CEU, CHBJPT)
11 4,661,091 4,661,091 SNP C/T 1000GP (CHBJPT)
11 4,661,104 4,661,104 SNP G/T 1000GP (CEU)
11 4,661,146 4,661,146 SNP A/C 1000GP (CEU, CHBJPT)
11 4,661,173 4,661,173 SNP C/G 1000GP (CEU, CHBJPT)
11 4,661,289 4,661,289 SNP G/A 1000GP (CEU, CHBJPT)
11 4,661,503 4,661,503 SNP G/A 1000GP (CEU, CHBJPT)
11 4,661,595 4,661,595 SNP T/C 1000GP (CEU)
11 4,661,652 4,661,652 SNP G/T 1000GP (CEU)
11 4,682,101 4,682,101 SNP C/T rs12278798 (DbSNP)
11 4,682,103 4,682,102 Ins(1) -/C rs35819223 (DbSNP)
11 4,682,197 4,682,196 Ins(1) -/G rs35852839 (DbSNP)
11 4,682,264 4,682,264 SNP A/G rs10768156 (DbSNP)
11 4,682,376 4,682,376 SNP A/C rs10768157 (DbSNP)
11 4,682,403 4,682,403 SNP C/G rs10768158 (DbSNP)
11 4,682,519 4,682,519 SNP A/G rs10768159 (DbSNP)
11 4,682,733 4,682,733 SNP A/G rs11033231 (DbSNP)
11 4,682,825 4,682,825 SNP T/C rs61741027 (DbSNP)
11 4,682,882 4,682,882 SNP G/T rs11033233 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 164 (Hasin)
11 4,682,272 4,683,077 InDel Variation_71251 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.