Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51AB1P Olfactory Receptor

Gene Symbol OR51AB1P1 (View this gene in GeneCards)
Family 51
Subfamily AB
Pseudogene Yes
CORP pseudogene probability score
Aliases
External Ids HGNC: 31278   GeneBank: NG_004424   
Build #39 labels
Chromosomal location 11:5,291,467-5,292,351 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51Q1 44.06% 202

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51Q1 45% 199
Chimp CONTIG*********** 46% 201
Mouse Or51q1c 48% 197
Rat Or51q1 47% 206
Cow OR51Q7P 47% 195

Sequence information

Nucleotide sequence AAACATCCCTATCTTTGATGCCTCTTTGTCTAGATCTCTATCCCCTCCTGTTTTCTCTAC
GTTATTTATATGGGTATCATCACCATCCTGGACAACATCAGGACAGATATCCCTCACCAA
GCCAATGTTCCTCTCTATGTTGGCTCAAATGTCCTTGAACTTTCCTTTCACCACCCTTTC
CACAGTCAAAAGGATATTGTAGTTTAATGCCTCAGAGTTCAGCTTTTAAGCTTCTGACAA
ATTATTCTTCCTCTTTAGGTTCTCCTTTATGGAATCTTCTGTACTGATGGCCATGTCCTT
TAACTACTATGTAGATATCTGCTACTACCTGTATTATGCCTCTACCTTTATTAGCAGAGT
TATCTGTACTGTTGGCATGACAATCATTTGTTAATATGACTTGCCTTTCCTTTTTCTGCT
ATTCTTGATCAAATGGCTCCTCTTTCTTGCTCCTCTCATTTCTCCTGCCTTCACTTGGAC
GTGCTTCACGTAGTCTGTGCTTATGACTGGATTAAAAATTGATATGGACTTATCCTAATG
TTGTTCGTCATAATATGGGTTTTATGGTCCATTATTATTTCCTATGCATTGATCTGGAGA
AGGCTTCAATCCTTTTACTCTTTGTGGAAAATATCTGTAAACCTTCTGGTTCACTCTGCT
ATAGCAATTTCAGTTTAGGCTAGTAAGCATGAGGATGCCTCCTTCTCTGATTTTTCCCAC
AGTCTGTTGGTCACAGAATAACCTGAGTGATTACTGATGAAAGAGTGAGAATGTTATTGA
TAGTCACAATGACAAAAAACAAACAACTACAGTCAAAATGTTTCTCTTTTTATTAGTGGA
TTATATTTCCTGACCTATATCTGGCAGGACTCTTTAGAGAGGTAG
Conceptual translation HPYLXLFVXSIPSCFLYVIYMGIITILDNIRTD//LTKPMFLSMLAQMSLNFPFTT
LSTVKRILXNASEFSFXSDKLFFLFRFSFMESSVLMAMSFNYYVDICYYLYYASTFIS
RVICTVGMTII/LIXAFPFSAILDQMAPLSCSSHFSCLHLDVLHVVCAYDWIKNXGL
ILMLFVIIWVLWSIIISYALIWRRLQSFYSLWKI/CKPSGSLCYSNFSLGXAXCLLL
XFPQSVGH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/A 1000GP (YRI, YRI, YRI)
11 5,291,492 5,291,492 SNP A/G 1000GP (CHBJPT)
11 5,292,305 5,292,305 SNP G/A 1000GP (CEU)
11 5,313,258 5,313,258 SNP G/T rs73404537 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,310,697 5,313,681 CopyNumber #59 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.