Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51B2 Olfactory Receptor

Gene Symbol OR51B21 (View this gene in GeneCards)
Family 51
Subfamily B
Pseudogene No
CORP pseudogene probability score
Aliases AF149710, HsOR11.3.57, ORL481
External Ids HGNC: 14703   GeneBank: AF399503   ORDB: ORL481   
Build #39 labels OR51B2, OR51B1P
Chromosomal location 11:5,323,362-5,324,297 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs7952293)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51B4 66.01% 306
OR51B5 67.43% 304
OR51B6 69.97% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51B18 79% 309
Chimp CONTIG*********** 95% 264
Mouse Or51b17 76% 306
Rat Or51b17 76% 305
Cow OR51B19P 60% 297

Expression evidences

Source Accession
mRNA BC117461

Sequence information

Nucleotide sequence ATGTGGCCCAATATTACTGCAGCCCCTTTTTTGCTGACTGGCTTTCCAGGGCTGGAGGCA
GCTCATCACTGGATCTCCATCCCCTTCTTTGCTGTTTATGTGTGCATCCTTCTGGGCAAT
GGCATGCTCCTCTACCTCATCAAGCATGACCACAGTCTTCATGAGCCCATGTACTACTTC
CTCACCATGCTGGCAGGCACAGACCTCATGGTGACATTGACCACGATGCCTACTGTAATG
GGCATCCTATGGGTGAATCACAGGGAGATTAGCAGTGTGGGCTGCTTCCTACAGGCTTAC
TTTATTCACTCCCTTTCTGTTGTGGAATCAGGTTCCCTCCTGGCAATGGCATATGATTGT
TTCATTGCCATCCGCAATCCTTTGAGATATGCTTCCATTCTCACCAATACTAGAGTCATA
GCGTTAGGAGTGGGAGTGTTTCTAAGGGGTTTTGTATCCATCCTGCCTGTAATTTTGCGT
CTTTTTTCATTTTCATATTGCAAATCTCATGTTATCACACGTGCTTTCTGCCTCCACCAA
GAAATCATGAGACTGGCTTGTGCTGACATAACTTTCAATAGACTTTACCCTGTAATTTTG
ATCTCTTTAACAATCTTCCTAGACTGTCTGATCATCCTCTTCTCCTATATTCTAATTCTT
AATACTGTCATAGGCATTGCTTCTGGTGAAGAGAGAGCCAAAGCCCTCAATACCTGTATC
TCCCACATTAGTTGTGTTCTTATCTTCTATGTTACAGTGATGGGTTTGACATTCATTTAC
AGATTTGGGAAGAATGTGCCAGAGGTTGTCCACATTATCATGAGTTACATCTACTTCCTC
TTTCCTCCTTTAATGAACCCTGTCATCTACAGCATCAAAACCAAGCAAATACAATATGGC
ATTATCCGCCTTTTATCTAAACATAGGTTTAGTAGT
Conceptual translation MWPNITAAPFLLTGFPGLEAAHHWISIPFFAVYVCILLGNGMLLYLIKHDHSLHEPMYYF
LTMLAGTDLMVTLTTMPTVMGILWVNHREISSVGCFLQAYFIHSLSVVESGSLLAMAYDC
FIAIRNPLRYASILTNTRVIALGVGVFLRGFVSILPVILRLFSFSYCKSHVITRAFCLHQ
EIMRLACADITFNRLYPVILISLTIFLDCLIILFSYILILNTVIGIASGEERAKALNTCI
SHISCVLIFYVTVMGLTFIYRFGKNVPEVVHIIMSYIYFLFPPLMNPVIYSIKTKQIQYG
IIRLLSKHRFSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A P/S 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/C T/T 1000GP (YRI, YRI, YRI, YRI)
11 5,323,362 5,323,362 NS A/C S/R 1000GP (CEU, CHBJPT)
11 5,323,451 5,323,451 NS G/A P/S 1000GP (CEU, CHBJPT)
11 5,323,542 5,323,542 SYN T/C T/T 1000GP (CEU, CHBJPT)
11 5,323,617 5,323,617 SYN A/G A/A 1000GP (CEU, CHBJPT)
11 5,323,672 5,323,672 NS C/G C/S 1000GP (CEU, CHBJPT)
11 5,323,738 5,323,738 NS C/A C/F 1000GP (CHBJPT)
11 5,323,898 5,323,898 NS G/A L/F 1000GP (CEU, CHBJPT)
11 5,323,940 5,323,940 NS A/G C/R 1000GP (CEU, CHBJPT)
11 5,324,256 5,324,256 SYN G/A G/G 1000GP (CEU, CHBJPT)
11 5,344,681 5,344,681 NS A/G S/P rs11036815 (DbSNP)
11 5,344,772 5,344,772 SYN C/T T/T rs10742622 (DbSNP)
11 5,344,847 5,344,847 SYN A/G A/A rs10768793 (DbSNP)
11 5,344,902 5,344,902 NS C/G C/S rs7937237 (DbSNP)
11 5,345,094 5,345,093 Ins(1) -/C rs34329019 (DbSNP)
11 5,345,128 5,345,128 NS A/G F/L rs10837814 (DbSNP)
11 5,345,170 5,345,170 NS A/G C/R rs7952293 (DbSNP)
11 5,345,486 5,345,486 SYN A/G G/G rs4910750 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,342,592 5,345,627 CopyNumber #60 (Waszak)
11 5,343,554 5,344,613 CopyNumber Variation_58522 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S312R S291N P283S C209S L134F C120R W2G % Freq CORP
1 S S P S F R W 30.88 0.315
2 S S S S L R W 27.11 0.379
3 S S P C L C W 25.73 0.853
4 R S P S F R W 11.37 0.315
5 S S P S L R W 3.99 0.245
6 S S P S F R G 0.54 0.315
7 S S S S L C W 0.15 0.916
8 S N P S L R W 0.15 0.245
9 S S S C L R W 0.08 0.379

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51B2.aApr07-unspliced main_exon 3UTR chr11 5,323,298 5,323,362 -
CDS chr11 5,323,362 5,324,297 -
5UTR chr11 5,324,297 5,324,352 -