Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51B5 Olfactory Receptor

Gene Symbol OR51B51 (View this gene in GeneCards)
Family 51
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR11-37, HsOR11.3.59
External Ids HGNC: 19599   GeneBank: BC022184, BK004430, NM_001005567   
Build #39 labels OR51B5
Chromosomal location 11:5,342,589-5,343,524 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51B2 67.43% 304
OR51B4 65.02% 303
OR51B6 70.92% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51B18 73% 304
Mouse Or51b6 75% 301
Rat Or51b6 74% 301
Cow OR51B19P 62% 291
Orang OR51B5P 95% 312
Horse OR51B6 72% 306
Chimp OR51B5BP 95% 312

Expression evidences

Source Accession
mRNA BC136708

Sequence information

Nucleotide sequence ATGTCGTCCAGCGGCAGCTCCCATCCCTTCCTATTGACTGGTTTTCCAGGCTTGGAGGAA
GCTCATCACTGGATTTCCGTATTTTTCTTGTTCATGTATATATCCATCCTTTTTGGCAAT
GGCACCCTCCTTCTTCTCATTAAGGAAGATCACAATCTTCATGAGCCCATGTACTTCTTT
CTGGCCATGCTGGCTGCCACAGACCTGGGGCTGGCCCTGACCACAATGCCCACGGTGCTG
GGAGTCCTCTGGCTGGATCACAGGGAGATTGGAAGTGCGGCCTGCTTTTCCCAGGCCTAC
TTTATACACTCACTTTCCTTTCTCGAGTCTGGCATTCTGCTTGCCATGGCCTATGACCGT
TTTATTGCCATCTGCAACCCTCTTAGATATACCTCTGTACTTACTAATACTCGAGTAGTG
AAGATTGGGCTGGGAGTTCTGATGAGGGGATTTGTATCCGTTGTTCCCCCAATCAGGCCC
CTCTATTTTTTTCTGTATTGTCACTCCCATGTTCTTTCACATGCATTCTGCCTTCACCAG
GATGTCATTAAACTCGCCTGTGCTGATACCACCTTCAACCGACTGTACCCAGCTGTGCTT
GTAGTCTTTATATTTGTGCTGGATTATCTGATTATCTTCATCTCCTATGTGTTGATACTC
AAGACTGTCCTGAGCATTGCCTCCAGAGAGGAGAGGGCCAAGGCTCTCATTACCTGTGTC
TCCCATATCTGCTGTGTCCTGGTTTTTTATGTCACAGTGATTGGATTGTCTCTGATTCAT
CGTTTTGGAAAGCAGGTTCCACATATTGTTCACCTCATTATGAGCTATGCCTATTTTCTG
TTCCCTCCACTAATGAATCCTATAACATATAGTGTCAAGACCAAGCAGATTCAGAATGCC
ATTCTTCACCTTTTTACTACCCATAGAATTGGAACC
Conceptual translation MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKEDHNLHEPMYFF
LAMLAATDLGLALTTMPTVLGVLWLDHREIGSAACFSQAYFIHSLSFLESGILLAMAYDR
FIAICNPLRYTSVLTNTRVVKIGLGVLMRGFVSVVPPIRPLYFFLYCHSHVLSHAFCLHQ
DVIKLACADTTFNRLYPAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCV
SHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLIMSYAYFLFPPLMNPITYSVKTKQIQNA
ILHLFTTHRIGT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A L/F 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/C S/S 1000GP (YRI, YRI, YRI)
11 5,342,783 5,342,783 NS C/T V/I 1000GP (CHBJPT)
11 5,343,046 5,343,046 NS G/A P/L 1000GP (CEU, CHBJPT)
11 5,343,065 5,343,065 NS C/T V/I 1000GP (CEU)
11 5,343,201 5,343,201 SYN G/A L/L 1000GP (CEU)
11 5,343,220 5,343,220 NS A/G I/T 1000GP (CEU, CHBJPT)
11 5,343,246 5,343,246 SYN C/T A/A 1000GP (CEU)
11 5,343,263 5,343,263 NS T/C R/G 1000GP (CEU)
11 5,343,292 5,343,292 NS G/T T/K 1000GP (CEU)
11 5,343,512 5,343,512 NS C/T G/S 1000GP (CEU, CHBJPT)
11 5,363,840 5,363,840 Del(1) -/A rs34017644 (DbSNP)
11 5,364,097 5,364,097 NS A/G F/L rs7120319 (DbSNP)
11 5,364,174 5,364,174 NS T/C Q/R rs61743611 (DbSNP)
11 5,364,276 5,364,276 NS A/G L/P rs4910551 (DbSNP)
11 5,364,295 5,364,295 NS C/T V/I rs12273630 (DbSNP)
11 5,364,296 5,364,296 SYN C/G S/S rs62000378 (DbSNP)
11 5,364,431 5,364,431 SYN A/G L/L rs58233587 (DbSNP)
11 5,364,450 5,364,450 NS A/G I/T rs11036912 (DbSNP)
11 5,364,471 5,364,471 NS C/G C/S rs61738484 (DbSNP)
11 5,364,476 5,364,476 SYN T/C A/A rs61738485 (DbSNP)
11 5,364,493 5,364,493 NS C/T G/R rs57900141 (DbSNP)
11 5,364,522 5,364,522 NS G/T T/K rs57273781 (DbSNP)
11 5,364,742 5,364,742 NS C/T G/S rs11036913 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V248I L220F H179Y P160L V154I I102T C95S R88G T78K G5S % Freq CORP
1 V L H L V T C R T G 27.50 0.059
2 V L H P V I C R T S 27.04 0.059
3 V L H P V I C R T G 23.58 0.059
4 V L H P I I C G K G 10.06 0.059
5 V F H P V I C R T G 7.45 0.059
6 V L H L V T C G T G 1.23 0.059
7 V L Y L V T C R T G 1.08 0.059
8 V L H L V T S R T G 0.69 0.836
9 I L H P V I C R T S 0.54 0.059
10 V L H P V I C G K G 0.31 0.059
11 V L H P I I C G T G 0.08 0.059
12 V L H P V T C R T G 0.08 0.059
13 V L H P V I S R T S 0.08 0.836
14 V L H L I I C R T S 0.08 0.059
15 V L H L V T S R K G 0.08 0.836
16 V L H L I I C R T G 0.08 0.059
17 V L H P V T S R T G 0.08 0.836

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51B5.aApr07 main_exon 3UTR chr11 5,342,586 5,342,589 -
CDS chr11 5,342,589 5,343,524 -
5UTR chr11 5,343,524 5,343,629 -
exon_5UTR chr11 5,345,773 5,345,899 -
exon_5UTR chr11 5,346,262 5,346,353 -
exon_5UTR chr11 5,346,876 5,346,910 -