Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51B6 Olfactory Receptor

Gene Symbol OR51B61 (View this gene in GeneCards)
Family 51
Subfamily B
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR11.3.60
External Ids HGNC: 19600   GeneBank: NM_001004750   
Build #39 labels OR51B6
Chromosomal location 11:5,351,508-5,352,443 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51B2 69.97% 303
OR51B4 67.97% 306
OR51B5 70.92% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51B6 88% 312
Chimp CONTIG*********** 96% 312
Chimp CONTIG130357.1-476 94% 270
Mouse Or51b6 86% 312
Rat Or51b6 86% 312
Rat Or51b6c-ps 82% 310
Rat Or51b6b 81% 310
Cow OR51B19P 71% 300

Expression evidences

Source Accession
mRNA AB463972

Sequence information

Nucleotide sequence ATGGGGCTCAATAAGTCTGCTTCCACCTTCCAGCTTACTGGCTTCCCAGGCATGGAGAAG
GCACATCACTGGATATTCATCCCATTATTGGCAGCCTACATCTCCATACTTCTTGGCAAT
GGCACTCTTCTCTTTCTCATCAGGAATGATCATAACCTCCATGAGCCCATGTACTATTTC
TTAGCTATGTTGGCAGCTACAGACCTCGGAGTGACATTGACCACAATGCCCACAGTGCTA
GGTGTTCTGTGGTTAGATCACAGGGAGATTGGCCATGGAGCCTGCTTCTCTCAGGCCTAT
TTTATCCATACTCTTTCTGTCATGGAGTCAGGTGTCTTGCTTGCCATGGCTTATGACTGT
TTCATTACCATCCGCAGCCCCTTAAGATATACCTCTATCCTGACCAACACCCAGGTAATG
AAGATTGGTGTGCGGGTATTGACAAGGGCTGGTCTGTCCATTATGCCAATAGTTGTTCGC
CTACACTGGTTTCCCTACTGTCGATCCCATGTACTCTCCCATGCTTTCTGTCTACACCAA
GATGTCATCAAGCTAGCCTGTGCTGACATCACCTTCAACCGTCTCTATCCAGTTGTAGTT
TTATTTGCAATGGTCTTGTTGGACTTTCTCATCATCTTTTTCTCCTACATTTTGATTCTC
AAGACTGTCATGGGCATTGGTTCTGGAGGAGAAAGGGCCAAGGCCCTCAACACATGTGTC
TCTCATATCTGCTGCATCCTGGTCTTCTATGTCACTGTAGTTTGTCTGACATTTATTCAT
AGGTTTGGAAAGCATGTTCCTCATGTCGTTCACATCACAATGAGCTACATCCACTTCCTT
TTCCCACCTTTTATGAACCCATTTATCTATAGCATTAAAACTAAGCAGATTCAGAGTGGC
ATACTTCGTTTATTCTCTCTGCCTCACTCTAGAGCA
Conceptual translation MGLNKSASTFQLTGFPGMEKAHHWIFIPLLAAYISILLGNGTLLFLIRNDHNLHEPMYYF
LAMLAATDLGVTLTTMPTVLGVLWLDHREIGHGACFSQAYFIHTLSVMESGVLLAMAYDC
FITIRSPLRYTSILTNTQVMKIGVRVLTRAGLSIMPIVVRLHWFPYCRSHVLSHAFCLHQ
DVIKLACADITFNRLYPVVVLFAMVLLDFLIIFFSYILILKTVMGIGSGGERAKALNTCV
SHICCILVFYVTVVCLTFIHRFGKHVPHVVHITMSYIHFLFPPFMNPFIYSIKTKQIQSG
ILRLFSLPHSRA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/C K/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/A T/T 1000GP (YRI, YRI, YRI)
11 5,351,521 5,351,521 NS A/C K/T 1000GP (CEU, CHBJPT)
11 5,351,626 5,351,626 NS A/G N/S 1000GP (CEU)
11 5,351,633 5,351,633 SYN T/A T/T 1000GP (CEU, CHBJPT)
11 5,351,651 5,351,651 SYN G/A R/R 1000GP (CEU, CHBJPT)
11 5,351,776 5,351,776 NS T/C I/T 1000GP (CEU, CHBJPT)
11 5,351,865 5,351,865 NS T/C C/R 1000GP (CEU, CHBJPT)
11 5,351,874 5,351,874 NS A/G T/A 1000GP (CEU, CHBJPT)
11 5,351,881 5,351,881 NS G/A R/H 1000GP (CEU, CHBJPT)
11 5,351,884 5,351,884 NS G/A S/N 1000GP (CEU, CHBJPT)
11 5,351,894 5,351,894 NS A/C R/S 1000GP (CEU)
11 5,351,899 5,351,899 NS C/T T/I 1000GP (CEU, CHBJPT)
11 5,351,940 5,351,940 NS C/G R/G 1000GP (CEU, CHBJPT)
11 5,352,012 5,352,012 NS T/G S/A 1000GP (CEU, CHBJPT)
11 5,352,021 5,352,021 NS C/T L/F 1000GP (CEU, CHBJPT)
11 5,352,079 5,352,079 NS C/A T/N 1000GP (CEU, CHBJPT)
11 5,352,081 5,352,081 NS T/C F/L 1000GP (CEU, CHBJPT)
11 5,352,104 5,352,104 SYN A/G V/V 1000GP (CEU, CHBJPT)
11 5,352,267 5,352,267 NS G/C V/L 1000GP (CEU, CHBJPT)
11 5,352,332 5,352,332 NS C/A S/R 1000GP (CEU, CHBJPT)
11 5,352,416 5,352,416 SYN T/C R/R 1000GP (CEU, CHBJPT)
11 5,352,422 5,352,422 NS C/G F/L 1000GP (CEU)
11 5,372,751 5,372,751 NS A/C K/T rs4910755 (DbSNP)
11 5,372,856 5,372,856 NS A/G N/S rs4910756 (DbSNP)
11 5,372,863 5,372,863 SYN A/T T/T rs10837882 (DbSNP)
11 5,373,006 5,373,006 NS C/T T/I rs7483122 (DbSNP)
11 5,373,104 5,373,104 NS A/G T/A rs5006889 (DbSNP)
11 5,373,111 5,373,111 NS A/G H/R rs7479477 (DbSNP)
11 5,373,114 5,373,114 NS A/G N/S rs5006888 (DbSNP)
11 5,373,129 5,373,129 NS C/T T/I rs5006887 (DbSNP)
11 5,373,170 5,373,170 NS C/G R/G rs5006886 (DbSNP)
11 5,373,242 5,373,242 NS G/T A/S rs5006885 (DbSNP)
11 5,373,251 5,373,251 NS C/T L/F rs5006884 (DbSNP)
11 5,373,311 5,373,311 NS C/T L/F rs5006883 (DbSNP)
11 5,373,334 5,373,334 SYN A/G V/V rs5006882 (DbSNP)
11 5,373,497 5,373,497 NS C/G L/V rs7106330 (DbSNP)
11 5,373,562 5,373,562 NS A/C R/S rs5024042 (DbSNP)
11 5,373,646 5,373,646 SYN C/T R/R rs5024041 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,372,010 5,384,809 CopyNumber Variation_71259 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K5T N40S I90T C120R T131I R145G S169A L172F V254L S275R L280F R303C F305L % Freq CORP
1 K N I C T R S L V S L R F 66.13 1.000
2 K N I C T R S L L S L R F 10.14 1.000
3 T S T C I G A F V R L R F 9.52 1.000
4 T N T R I G A F V R L R F 6.22 1.000
5 T S T R I G A F V R L R F 4.38 1.000
6 T N T R I G A F V R F R F 1.08 1.000
7 K N I C T R A L V S L R F 0.77 1.000
8 K N I C T R S L L S L R L 0.46 1.000
9 T S I C I G A F V R L R F 0.23 1.000
10 T S T C I G A F V R L C F 0.23 1.000
11 T S T R T G A F V R L R F 0.15 1.000
12 K N T C I G A F V S L R F 0.15 1.000
13 T S T C T G A F V S L R F 0.15 1.000
14 T S T C T G A F V R L R F 0.08 1.000
15 T S T C I G A F V S L R F 0.08 1.000
16 T S T R T R S L V S L R F 0.08 1.000
17 K N I C T G S L V S L R F 0.08 1.000
18 T S T C I G A L V R L R F 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51B6.aApr07-unspliced main_exon CDS chr11 5,351,508 5,352,443 +
3UTR chr11 5,352,443 5,352,446 +