Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51C1P Olfactory Receptor

Gene Symbol OR51C1P1 (View this gene in GeneCards)
Family 51
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.17P, ORL3440
External Ids HGNC: 15191   GeneBank: AB065521, NG_004228   ORDB: ORL3440   
Build #39 labels OR51C1P, OR51C3P, OR51C2P
Chromosomal location 11:4,690,761-4,691,702 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51C4P 77.35% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51C4 82% 311
Chimp CONTIG465.144-32930 93% 314
Mouse Or51c4b 80% 311
Rat Or51c4b-ps 79% 312
Cow OR51C4D 81% 313

Expression evidences

Source Accession
ESTs DR005889
mRNA AK314051
GNF Atlas2 gnf1h05436_s_at
GNF Atlas2 gnf1h10693_at

Sequence information

Nucleotide sequence ACGTCAACTTTGCAGAATATCACCTCCACTTCCATCATTTTCCTGCTCACTGGTGTTCCT
GGGCTGGAAGCCTTCCACACCTGGATCTCCATTCCCTTCTGCTTCCTCTCTGTAACTGCT
CTCTTGGGAAACAGCCTGATCCTCTTCGCTACCATCACTCAGCCCAGCCTCCACGAACCA
ATGTACTATTTCCTCTCCATGCTGTCCGCCACTGACCTCGGCCTGTCCATATCCACTCTG
GTCACCATGCTGAGTATATTCTGGTTCAATGTGAGGGAAATCAGCTTTAATGCCTGCTTG
TCCCACATGTTCTTTATTAAATTCTTCACTGTCATGGAATCCTCAGTGCTGTTGGCCATG
GCTTTTGATCGTTTTGTGGCCGTCTCTAATCCCCTTAGGTATGCCATGATTTTAACTGAC
TCCAGAATAGCTCAAATTGGAGTGGCAAGTGTCATCAGGGGGCTCCTAATGCTGACACCA
ATGGTAGCACTTCTTATAAGACTTTCCTACTGCCACAGCCAAGTACTCCACCACTCCTAC
TGCTACCACCCTGATGTGATGAAGCTCTCATGCACAGACACCAGAATCAACAGTGCAGTT
GGGCTGACTGCCATGTTCTCTACTGTTGGTGTAGACTTACTTCTCATCCTCCTTTCTTAT
GTTTTGATCATTAGGACTGTCCTTAGCGTTGCTTCCCCAGAAGAGAGGAAGGAAACCTTC
AGTACATGTGTCTCCCACATTGTGGCTTTTGCTATATATTACATTCCATTGATCAGTCTG
TCCATTGTTCACAGATTTGGGAAACAAGCCCCAGCCTATGTACATACTATGATTGCTAAC
ACCTACCTGCTGATCTCCCCTTTGATGAACCCTGTCATCTACAGTGTGAAAACCAAACAG
ATACGTAGAGCTGTGATAAAAATTCTCCATTCCAAAGAAACA
Conceptual translation TSTLQNITSTSIIFLLTGVPGLEAFHTWISIPFCFLSVTALLGNSLILFATITQPSLHEP
MYYFLSMLSATDLGLSISTLVTMLSIFWFNVREISFNACLSHMFFIKFFTVMESSVLLAM
AFDRFVAVSNPLRYAMILTDSRIAQIGVASVIRGLLMLTPMVALLIRLSYCHSQVLHHSY
CYHPDVMKLSCTDTRINSAV/ADCHVLYCWCRLTS\LLSYVLIIRTVLSVASPEERKE
TFSTCVSHIVAFAIYYIPLISLSIVHRFGKQAPAYVHTMIANTYLLISPLMNPVIYSVKT
KQIRRAVIKILHSKET

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI)
11 4,690,849 4,690,849 SNP A/G 1000GP (CEU, CHBJPT)
11 4,691,123 4,691,123 SNP T/C 1000GP (CEU, CHBJPT)
11 4,691,169 4,691,169 SNP G/A 1000GP (CHBJPT)
11 4,691,561 4,691,561 SNP G/A 1000GP (CHBJPT)
11 4,712,079 4,712,079 SNP G/A rs1505192 (DbSNP)
11 4,712,353 4,712,353 SNP C/T rs11033352 (DbSNP)
11 4,712,562 4,712,562 SNP C/T rs72865883 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.