Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51C4P Olfactory Receptor

Gene Symbol OR51C4P1 (View this gene in GeneCards)
Family 51
Subfamily C
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.19P
External Ids HGNC: 31280   GeneBank: NG_004322   
Build #39 labels OR51C4P
Chromosomal location 11:4,718,612-4,719,559 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51C1P 77.35% 309
OR51F3P 73.09% 301
OR51F4P 75.33% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51C4 85% 310
Chimp CONTIG465.144-5117 97% 316
Mouse Or51c4 88% 316
Mouse Or51c4b 83% 310
Mouse Or51c4c-ps 83% 309
Rat Or51c4 86% 316
Rat Or51c4b-ps 82% 310
Rat Or51c4c-ps 82% 316
Cow OR51C4 86% 316

Sequence information

Nucleotide sequence ATGTCAACTTTGCAGAATATCACCTCCACTTCCATCATTTTCCTGCTCCCTGGTGTTCCT
GGGCTGGAAGCCTTCCACACCTGGATCTCCATTCCCTTCTGCTTCCTCTATGTAACTGCC
CTCTCAGGAAACAGCCTGATCCTCTTTGCCATCGTTACTCAGCCCAGCCTCCACGAACCC
ATGTATTATTTCCTCTCCATGCTGTCCACCACTGACCTCGGCCTGTCCATATCCACTCTG
GTCACCATTCTGGGTATATTCTGCTTCAATGTGAGGGAAATCAGCTTTAATGCCCGCTTG
TCCCAGATGTTCTTTCTTCAACTCTTCACTGTCATGGAATCTTCAGTGCTGTTGGCCATG
GCTTTTGATCGTTTTGTGGCCATTACTAATCCTCTTAGATATGCTTCTGTCTTAACTGAT
CTTAAAATAGCACAGATTTGAGTAGCAATTATCACCAGGGGAACAATAACACTGACTCCT
ATGGTGTTGCTTCTTAAAAGACTGTCCTACTGCTGCAGCCACGTGCTCCACCACTCCTAT
TGCTTTTACCCTGATGTGATGAAGCTCTCATGCACAGACACCAGGATCAACAGTGCAGTT
GGGCTGACTGCCCTGATTACCACTGCTGGGGCAGATTCTGTCTTTATTGTCCTGTCTTAT
ATTTTGATCATTAAGACTGTTCTCAGCATTGCTTCCCCGGAAGAAAGGAAGAAAGCCTTC
AGCACATGTATCTCCCATATTGGGGCTGTTGCTGTATTTTACATTCCATTGATCACTCTG
TCCTTTGTTCACAGGTTTGGGAAGCAGGCCCCACCCTATGTGCATACTTTGATTGCCAAT
GCCTACCTACTAATCCCTCCTGTAATGAACCCCATCATCTACAGTGTGAAGACCAAACAG
ATACGCTAGGCTGTGCTAAAAGTACTCCATTGTAGCACGGCAAAGAAC
Conceptual translation MSTLQNITSTSIIFLLPGVPGLEAFHTWISIPFCFLYVTALSGNSLILFAIVTQPSLHEP
MYYFLSMLSTTDLGLSISTLVTILGIFCFNVREISFNARLSQMFFLQLFTVMESSVLLAM
AFDRFVAITNPLRYASVLTDLKIAQIXAIITRGTITLTPMVLLLKRLSYCCSHVLHHSY
CFYPDVMKLSCTDTRINSAVGLTALITTAGADSVFIVLSYILIIKTVLSIASPEERKKAF
STCISHIGAVAVFYIPLITLSFVHRFGKQAPPYVHTLIANAYLLIPPVMNPIIYSVKTKQ
IRXVLKVLHCSTAKN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,740,665 4,740,665 SNP A/G rs4498989 (DbSNP)
11 4,740,745 4,740,745 SNP C/T rs7104128 (DbSNP)
11 4,719,435 4,719,435 SNP A/G 1000GP (CEU, CHBJPT)
11 4,719,515 4,719,515 SNP C/T 1000GP (CEU, CHBJPT)
11 4,718,987 4,718,987 SNP G/T 1000GP (CHBJPT)
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.