Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51E1 Olfactory Receptor

Gene Symbol OR51E11 (View this gene in GeneCards)
Family 51
Subfamily E
Pseudogene No
CORP pseudogene probability score
Aliases OR11-15, HsOR11.3.14, ORL3299
External Ids HGNC: 15194   GeneBank: AB065787, AY698056, AY775731, BC022401, BK004369, NG_004227, NM_152430   ORDB: ORL3299   
Build #39 labels OR51E1, OR52A3P
Chromosomal location 11:4,652,527-4,653,480 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51E1 92% 316
Mouse Or51e1 94% 316
Rat Or51e1 93% 315
Cow OR51E1 93% 317

Expression evidences

Source Accession
ESTs DY308798
mRNA AK023643

Sequence information

Nucleotide sequence ATGATGGTGGATCCCAATGGCAATGAATCCAGTGCTACATACTTCATCCTAATAGGCCTC
CCTGGTTTAGAAGAGGCTCAGTTCTGGTTGGCCTTCCCATTGTGCTCCCTCTACCTTATT
GCTGTGCTAGGTAACTTGACAATCATCTACATTGTGCGGACTGAGCACAGCCTGCATGAG
CCCATGTATATATTTCTTTGCATGCTTTCAGGCATTGACATCCTCATCTCCACCTCATCC
ATGCCCAAAATGCTGGCCATCTTCTGGTTCAATTCCACTACCATCCAGTTTGATGCTTGT
CTGCTACAGATGTTTGCCATCCACTCCTTATCTGGCATGGAATCCACAGTGCTGCTGGCC
ATGGCTTTTGACCGCTATGTGGCCATCTGTCACCCACTGCGCCATGCCACAGTACTTACG
TTGCCTCGTGTCACCAAAATTGGTGTGGCTGCTGTGGTGCGGGGGGCTGCACTGATGGCA
CCCCTTCCTGTCTTCATCAAGCAGCTGCCCTTCTGCCGCTCCAATATCCTTTCCCATTCC
TACTGCCTACACCAAGATGTCATGAAGCTGGCCTGTGATGATATCCGGGTCAATGTCGTC
TATGGCCTTATCGTCATCATCTCCGCCATTGGCCTGGACTCACTTCTCATCTCCTTCTCA
TATCTGCTTATTCTTAAGACTGTGTTGGGCTTGACACGTGAAGCCCAGGCCAAGGCATTT
GGCACTTGCGTCTCTCATGTGTGTGCTGTGTTCATATTCTATGTACCTTTCATTGGATTG
TCCATGGTGCATCGCTTTAGCAAGCGGCGTGACTCTCCGCTGCCCGTCATCTTGGCCAAT
ATCTATCTGCTGGTTCCTCCTGTGCTCAACCCAATTGTCTATGGAGTGAAGACAAAGGAG
ATTCGACAGCGCATCCTTCGACTTTTCCATGTGGCCACACACGCTTCAGAGCCC
Conceptual translation MMVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHE
PMYIFLCMLSGIDILISTSSMPKMLAIFWFNSTTIQFDACLLQMFAIHSLSGMESTVLLA
MAFDRYVAICHPLRHATVLTLPRVTKIGVAAVVRGAALMAPLPVFIKQLPFCRSNILSHS
YCLHQDVMKLACDDIRVNVVYGLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAF
GTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKE
IRQRILRLFHVATHASEP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SYN G/A P/P 1000GP (YRI)
11 4,652,558 4,652,558 NS G/A S/N 1000GP (CEU)
11 4,653,345 4,653,345 SYN G/A P/P 1000GP (CEU, CHBJPT)
11 4,673,788 4,673,788 NS A/G N/S rs17224476 (DbSNP)
11 4,674,255 4,674,255 NS A/C K/Q rs61883652 (DbSNP)
11 4,674,282 4,674,282 NS A/G I/V rs61746313 (DbSNP)
11 4,674,575 4,674,575 SYN A/G P/P rs3817098 (DbSNP)
11 4,674,683 4,674,682 Ins(1) -/T rs36005201 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,673,657 4,676,710 CopyNumber #52 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S10N % Freq CORP
1 S 94.55 0.038
2 N 5.45 0.038

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51E1.aApr07 exon_5UTR chr11 4,643,420 4,644,030 +
main_exon 5UTR chr11 4,652,488 4,652,527 +
CDS chr11 4,652,527 4,653,480 +
3UTR chr11 4,653,480 4,655,487 +
OR51E1.bApr07-unspliced main_exon 5UTR chr11 4,652,330 4,652,527 +
CDS chr11 4,652,527 4,653,480 +
3UTR chr11 4,653,480 4,655,484 +
OR51E1.cApr07 exon_5UTR chr11 4,644,024 4,644,030 +
main_exon CDS_partial chr11 4,653,327 4,653,480 +
3UTR chr11 4,653,480 4,653,614 +