Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51E2 Olfactory Receptor

Gene Symbol OR51E21 (View this gene in GeneCards)
Family 51
Subfamily E
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-16, HsOR11.3.16, ORL3397
External Ids HGNC: 15195   GeneBank: AF311306, AF369708, BK004368   ORDB: ORL3397   
Build #39 labels OR51E2
Chromosomal location 11:4,681,752-4,682,711 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51D1 58.63% 307
OR51G2 56.39% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51E2 93% 320
Chimp CONTIG465.145-7476 100% 320
Mouse Or51e2 93% 319
Rat Or51e1 60% 296
Cow OR51E2 92% 320

Expression evidences

Source Accession
ESTs EL735395
mRNA CU676708
GNF Atlas2 221424_s_at

Sequence information

Nucleotide sequence ATGAGTTCCTGCAACTTCACACATGCCACCTTTGTGCTTATTGGTATCCCAGGATTAGAG
AAAGCCCATTTCTGGGTTGGCTTCCCCCTCCTTTCCATGTATGTAGTGGCAATGTTTGGA
AACTGCATCGTGGTCTTCATCGTAAGGACGGAACGCAGCCTGCACGCTCCGATGTACCTC
TTTCTCTGCATGCTTGCAGCCATTGACCTGGCCTTATCCACATCCACCATGCCTAAGATC
CTTGCCCTTTTCTGGTTTGATTCCCGAGAGATTAGCTTTGAGGCCTGTCTTACCCAGATG
TTCTTTATTCATGCCCTCTCAGCCATTGAATCCACCATCCTGCTGGCCATGGCCTTTGAC
CGTTATGTGGCCATCTGCCACCCACTGCGCCATGCTGCAGTGCTCAACAATACAGTAACA
GCCCAGATTGGCATCGTGGCTGTGGTCCGCGGATCCCTCTTTTTTTTCCCACTGCCTCTG
CTGATCAAGCGGCTGGCCTTCTGCCACTCCAATGTCCTCTCGCACTCCTATTGTGTCCAC
CAGGATGTAATGAAGTTGGCCTATGCAGACACTTTGCCCAATGTGGTATATGGTCTTACT
GCCATTCTGCTGGTCATGGGCGTGGACGTAATGTTCATCTCCTTGTCCTATTTTCTGATA
ATACGAACGGTTCTGCAACTGCCTTCCAAGTCAGAGCGGGCCAAGGCCTTTGGAACCTGT
GTGTCACACATTGGTGTGGTACTCGCCTTCTATGTGCCACTTATTGGCCTCTCAGTGGTA
CACCGCTTTGGAAACAGCCTTCATCCCATTGTGCGTGTTGTCATGGGTGACATCTACCTG
CTGCTGCCTCCTGTCATCAATCCCATCATCTATGGTGCCAAAACCAAACAGATCAGAACA
CGGGTGCTGGCTATGTTCAAGATCAGCTGTGACAAGGACTTGCAGGCTGTGGGAGGCAAG
Conceptual translation MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL
FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD
RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH
QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC
VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDLQAVGGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,703,654 4,703,654 SYN A/G C/C rs12575331 (DbSNP)
11 4,703,165 4,703,165 SYN C/A V/V rs1123991 (DbSNP)
11 4,703,420 4,703,420 SYN C/T S/S rs7939559 (DbSNP)
11 4,703,321 4,703,321 SYN G/A G/G rs1123990 (DbSNP)
11 4,703,762 4,703,762 SYN G/T L/L rs12576387 (DbSNP)
11 4,682,532 4,682,532 SYN G/T L/L 1000GP (CEU, CHBJPT)
11 4,682,190 4,682,190 SYN C/T S/S 1000GP (CEU, CHBJPT)
11 4,681,935 4,681,935 SYN C/A V/V 1000GP (CEU, CHBJPT)
11 4,682,091 4,682,091 SYN G/A G/G 1000GP (CHBJPT)
11 4,682,424 4,682,424 SYN A/G C/C 1000GP (CHBJPT)
11 100 -100 SYN C/A V/V 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 200 (Hasin)
11 4,700,982 4,704,041 CopyNumber #53 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T112S A56S % Freq CORP
1 T A 98.95 0.040
2 S A 0.73 0.040
3 T S 0.31 0.040

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51E2.aApr07 main_exon 3UTR chr11 4,680,171 4,681,752 -
CDS chr11 4,681,752 4,682,711 -
5UTR chr11 4,682,711 4,682,761 -
exon_5UTR chr11 4,697,653 4,697,845 -
OR51E2.bApr07 main_exon CDS_partial chr11 4,682,461 4,682,711 -
5UTR chr11 4,682,711 4,682,761 -
exon_5UTR chr11 4,697,653 4,697,845 -