Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51F1 Olfactory Receptor

Gene Symbol OR51F11 (View this gene in GeneCards)
Family 51
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.76 (pseudogene)
Aliases OR11-21, HsOR11.3.22
External Ids HGNC: 15196   GeneBank: NM_001004752   
Build #39 labels OR51F1P
Chromosomal location 11:4,768,982-4,769,917 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a polymorphism of C->del at position 274

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51F2 63.14% 312
OR51F3P 62.16% 296
OR51F5P 62.88% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51F2 66% 312
Mouse Or51f1 82% 311
Rat Or51f1 79% 311
Cow OR51F1B 82% 312
Orang OR51F1P 92% 312
Horse OR51F1C 81% 312
Chimp OR51F1P 97% 268

Expression evidences

Source Accession
mRNA BC172882

Sequence information

Nucleotide sequence ATGGAAATCCTAAGCAACTCAACATCTAAATTTCCAACCTTCTTGTTGACCGGCATTCCT
GGCCTAGAGTCTGCCCATGTCTGGATCTCCATTCCTTTCTGTTGTTTTTATGCCATTGCC
CTCTCTGGGAACAGCGTGATCCTGTTTGTCATCATTACCCAGCAGAGTCTCCATGAACCC
ATGTATTATTTCCTCTTCAGGCTATCAGCCACTGATCTGGGCTTGACTGTTTCTTCATTG
TCAACAACATTAGGTATCCTCTGGTTTGAGGCACGTGAAATCAGTCTATATAGCTGCATT
GTCCAGATGTTTTTTCTTCATGGATTCACTTTTATGGAATCTGGAGTGCTGGTGGCTACA
GCCTTTGACCGTTATGTGGCCATCTGTGACCCTCTGAGGTACACTACCATTCTCACTAAT
TCCAGAATCATTCAAATGGGTCTTCTGATGATTACACGTGCTATAGTACTAATATTGCCA
CTACTTTTGCTCCTTAAGCCTCTCTATTTCTGTAGAATGAATGCCCTTTCTCACTCCTAT
TGTTACCATCCAGATGTGATTCAATTAGCATGTTCAGACATTCGGGCAAATAGCATCTGT
GGATTAATTGATCTCATCCTGACCACTGGAATAGATACACCATGCATTGTCCTGTCATAT
ATCTTAATTATTCACTCTGTCCTCAGAATTGCCTCCCCTGAAGAATGGCACAAGGTCTTC
AGCACCTGTGTCTCCCATGTGGGAGCAGTTGCTTTCTTCTACATCCACATGCTGAGCCTG
TCCTTGGTGTATCGCTATGGTCGGTCAGCCCCCAGAGTAGTCCATTCAGTGATGGCTAAT
GTATACCTGCTTTTACCCCCTGTGCTCAACCCCATCATCGACAGTGTAAAAACAAAACAA
ATCCGCAAGGCTATGCTCAGTCTGCTGCTTACAAAA
Conceptual translation MEILSNSTSKFPTFLLTGIPGLESAHVWISIPFCCFYAIALSGNSVILFVIITQQSLHEP
MYYFLFRLSATDLGLTVSSLSTTLGILWFEAREISLYSCIVQMFFLHGFTFMESGVLVAT
AFDRYVAICDPLRYTTILTNSRIIQMGLLMITRAIVLILPLLLLLKPLYFCRMNALSHSY
CYHPDVIQLACSDIRANSICGLIDLILTTGIDTPCIVLSYILIIHSVLRIASPEEWHKVF
STCVSHVGAVAFFYIHMLSLSLVYRYGRSAPRVVHSVMANVYLLLPPVLNPIIDSVKTKQ
IRKAMLSLLLTK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/A D/Y 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G N/N 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 4,769,038 4,769,038 NS C/A D/Y 1000GP (CEU)
11 4,769,078 4,769,078 SYN A/G N/N 1000GP (CEU)
11 4,769,166 4,769,166 NS G/A A/V 1000GP (CEU)
11 4,769,180 4,769,180 SYN A/G H/H 1000GP (CEU)
11 4,769,241 4,769,241 NS G/A S/F 1000GP (CEU)
11 4,769,244 4,769,244 NS T/C H/R 1000GP (CEU)
11 4,769,252 4,769,252 SYN T/C L/L 1000GP (CEU)
11 4,769,345 4,769,345 SYN A/G C/C 1000GP (CEU)
11 4,769,375 4,769,375 SYN A/G C/C 1000GP (CEU)
11 4,769,441 4,769,441 SYN C/T L/L 1000GP (CEU)
11 4,769,528 4,769,528 SYN G/A D/D 1000GP (CEU)
11 4,769,627 4,769,627 SYN A/G Y/Y 1000GP (CEU)
11 4,769,651 4,769,651 SYN A/G F/F 1000GP (CEU)
11 4,769,660 4,769,660 SYN G/A I/I 1000GP (CHBJPT)
11 4,769,691 4,769,691 NS G/A T/I 1000GP (CHBJPT)
11 4,769,718 4,769,718 NS C/A R/M 1000GP (CEU)
11 4,769,721 4,769,721 NS A/G F/S 1000GP (CEU)
11 4,769,881 4,769,881 NS T/C T/A 1000GP (CEU, CHBJPT)
11 4,790,268 4,790,268 NS C/A D/Y rs1030726 (DbSNP)
11 4,790,308 4,790,308 SYN G/A N/N rs1030725 (DbSNP)
11 4,790,396 4,790,396 NS A/G V/A rs17324609 (DbSNP)
11 4,790,410 4,790,410 SYN G/A H/H rs1030724 (DbSNP)
11 4,790,471 4,790,471 NS G/A S/F rs1030723 (DbSNP)
11 4,790,474 4,790,474 NS C/T R/H rs11033793 (DbSNP)
11 4,790,482 4,790,482 SYN C/T L/L rs12792898 (DbSNP)
11 4,790,564 4,790,564 NS C/T R/Q rs16938368 (DbSNP)
11 4,790,575 4,790,575 SYN A/G C/C rs12788102 (DbSNP)
11 4,790,671 4,790,671 SYN C/T L/L rs11033795 (DbSNP)
11 4,790,682 4,790,682 NS C/T V/I rs74052100 (DbSNP)
11 4,790,758 4,790,758 SYN A/G D/D rs11033796 (DbSNP)
11 4,790,857 4,790,857 SYN A/G Y/Y rs11033797 (DbSNP)
11 4,790,874 4,790,874 Del(1) -/G rs34672924 (DbSNP)
11 4,790,948 4,790,948 NS A/C M/R rs11033800 (DbSNP)
11 4,790,951 4,790,951 NS A/G F/S rs11033801 (DbSNP)
11 4,791,046 4,791,046 SYN A/G C/C rs16938394 (DbSNP)
11 4,791,111 4,791,111 NS C/T A/T rs17324812 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,790,280 4,790,889 InDel Variation_71252 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K312E D294Y A251V S226F H225R H225Y R195Q V156I T76I R67M F66S P32R T13A % Freq CORP
1 K D A S H H R V T R F P T 60.29 0.802
2 K D A S H H R V T R F P A 13.67 0.802
3 K Y A F R H R V T M S P T 13.59 0.802
4 K Y V S H H R V T M S P T 5.99 0.802
5 K Y A F R Y R V T M S P T 2.00 0.802
6 K D A S H H R I T R F P T 1.08 0.802
7 K D A S H H R V I R F P T 0.92 0.802
8 K Y A S H H R V T M S P T 0.77 0.802
9 K Y V S H H R V T R F P T 0.46 0.802
10 K Y A S H H R V T R F P T 0.31 0.802
11 E Y A F R H R V T M S P T 0.31 0.802
12 K D A F R H R V T M S P T 0.15 0.802
13 K Y A F R H Q V T M S P T 0.15 0.802
14 K D A S H H R V T R F R T 0.15 0.802
15 K D A S H H R V T M S P T 0.08 0.802
16 K D A S H H Q V T R F P T 0.08 0.802

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51F1.aApr07-unspliced main_exon 3UTR chr11 4,768,979 4,768,982 -
CDS chr11 4,768,982 4,769,917 -